Recombinant Human EPCAM protein(161-250 aa), C-His-tagged
| Cat.No. : | EPCAM-2666H |
| Product Overview : | Recombinant Human EPCAM protein(P16422)(161-250 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 161-250 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | SLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIY |
| Gene Name | EPCAM epithelial cell adhesion molecule [ Homo sapiens ] |
| Official Symbol | EPCAM |
| Synonyms | EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH99; MK 1; MOC31; TACST 1; TROP1; epithelial glycoprotein 314; human epithelial glycoprotein-2; cell surface glycoprotein Trop-1; adenocarcinoma-associated antigen; tumor-associated calcium signal transducer 1; major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); M4S1; MK-1; DIAR5; EGP-2; MIC18; EGP314; HNPCC8; TACSTD1; GA733-2; |
| Gene ID | 4072 |
| mRNA Refseq | NM_002354 |
| Protein Refseq | NP_002345 |
| MIM | 185535 |
| UniProt ID | P16422 |
| ◆ Recombinant Proteins | ||
| EPCAM-207H | Recombinant Human EPCAM Protein, His\Avi-tagged | +Inquiry |
| EPCAM-572H | Recombinant Human EPCAM protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
| Epcam-7481RAF555 | Recombinant Rat Epcam Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| EPCAM-077H | Recombinant Human EPCAM Protein, GLN24-LYS265, ECD, Tag Free, Biotinylated | +Inquiry |
| Epcam-36M | Recombinant Mouse Epcam Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPCAM-1434RCL | Recombinant Rat EPCAM cell lysate | +Inquiry |
| EPCAM-2143MCL | Recombinant Mouse EPCAM cell lysate | +Inquiry |
| EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
| EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPCAM Products
Required fields are marked with *
My Review for All EPCAM Products
Required fields are marked with *



