Recombinant Human EPCAM protein, His-SUMO-tagged
Cat.No. : | EPCAM-2855H |
Product Overview : | Recombinant Human EPCAM protein(P16422)(24-265aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-265aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.4 kDa |
AA Sequence : | QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | EPCAM epithelial cell adhesion molecule [ Homo sapiens ] |
Official Symbol | EPCAM |
Synonyms | EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH99; MK 1; MOC31; TACST 1; TROP1; epithelial glycoprotein 314; human epithelial glycoprotein-2; cell surface glycoprotein Trop-1; adenocarcinoma-associated antigen; tumor-associated calcium signal transducer 1; major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); M4S1; MK-1; DIAR5; EGP-2; MIC18; EGP314; HNPCC8; TACSTD1; GA733-2; |
Gene ID | 4072 |
mRNA Refseq | NM_002354 |
Protein Refseq | NP_002345 |
MIM | 185535 |
UniProt ID | P16422 |
◆ Recombinant Proteins | ||
Epcam-283MAF647 | Recombinant Mouse Epcam Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
EPCAM-81H | Recombinant Human EPCAM, Fc tagged | +Inquiry |
EPCAM-2938H | Recombinant Human EPCAM protein, His-tagged, Site-Specific PE-Labeled | +Inquiry |
EPCAM-1307R | Recombinant Rhesus Macaque EPCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
EPCAM-2666H | Recombinant Human EPCAM protein(161-250 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPCAM-2143MCL | Recombinant Mouse EPCAM cell lysate | +Inquiry |
EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
EPCAM-1434RCL | Recombinant Rat EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPCAM Products
Required fields are marked with *
My Review for All EPCAM Products
Required fields are marked with *