Recombinant Human EPCAM Protein, His-tagged
| Cat.No. : | EPCAM-097H |
| Product Overview : | Recombinant Human EPCAM Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Epithelial cell adhesion and activating molecule (EpCAM/CD326) is a transmembrane glycoprotein that mediates Ca2+-independent, homophilic adhesions on the basolateral surface of most epithelial cells. EpCAM is not expressed in adult squamous epithelium, but it is highly expressed in adeno and squamous cell carcinomas. Research studies identified EpCAM as one of the first tumor-associated antigens, and it has long been a marker of epithelial and tumor tissue. Investigators have shown that EpCAM is highly expressed in cancer cells. |
| Molecular Mass : | ~32 kDa |
| AA Sequence : | QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | EPCAM epithelial cell adhesion molecule [ Homo sapiens (human) ] |
| Official Symbol | EPCAM |
| Synonyms | EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH99; MK 1; MOC31; TACST 1; TROP1; epithelial glycoprotein 314; human epithelial glycoprotein-2; cell surface glycoprotein Trop-1; adenocarcinoma-associated antigen; tumor-associated calcium signal transducer 1; major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); M4S1; MK-1; DIAR5; EGP-2; MIC18; EGP314; HNPCC8; TACSTD1; GA733-2; |
| Gene ID | 4072 |
| mRNA Refseq | NM_002354 |
| Protein Refseq | NP_002345 |
| MIM | 185535 |
| UniProt ID | P16422 |
| ◆ Recombinant Proteins | ||
| Epcam-191MAF647 | Active Recombinant Mouse Epcam Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| EPCAM-418H | Recombinant Human EPCAM Protein (Met1-Lys265), HIgG1 Fc-tagged, Biotinylated | +Inquiry |
| Epcam-7482RAF647 | Recombinant Rat Epcam Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| EPCAM-223H | Recombinant Human EPCAM Protein, Strep-tagged | +Inquiry |
| EPCAM-64H | Recombinant Human EPCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
| EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
| EPCAM-2143MCL | Recombinant Mouse EPCAM cell lysate | +Inquiry |
| EPCAM-1434RCL | Recombinant Rat EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPCAM Products
Required fields are marked with *
My Review for All EPCAM Products
Required fields are marked with *
