Recombinant Human EPCAM Protein, His-tagged

Cat.No. : EPCAM-097H
Product Overview : Recombinant Human EPCAM Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Epithelial cell adhesion and activating molecule (EpCAM/CD326) is a transmembrane glycoprotein that mediates Ca2+-independent, homophilic adhesions on the basolateral surface of most epithelial cells. EpCAM is not expressed in adult squamous epithelium, but it is highly expressed in adeno and squamous cell carcinomas. Research studies identified EpCAM as one of the first tumor-associated antigens, and it has long been a marker of epithelial and tumor tissue. Investigators have shown that EpCAM is highly expressed in cancer cells.
Molecular Mass : ~32 kDa
AA Sequence : QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name EPCAM epithelial cell adhesion molecule [ Homo sapiens (human) ]
Official Symbol EPCAM
Synonyms EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH99; MK 1; MOC31; TACST 1; TROP1; epithelial glycoprotein 314; human epithelial glycoprotein-2; cell surface glycoprotein Trop-1; adenocarcinoma-associated antigen; tumor-associated calcium signal transducer 1; major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); M4S1; MK-1; DIAR5; EGP-2; MIC18; EGP314; HNPCC8; TACSTD1; GA733-2;
Gene ID 4072
mRNA Refseq NM_002354
Protein Refseq NP_002345
MIM 185535
UniProt ID P16422

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPCAM Products

Required fields are marked with *

My Review for All EPCAM Products

Required fields are marked with *

0
cart-icon
0
compare icon