Recombinant Human EPGN Protein, GST-tagged

Cat.No. : EPGN-3373H
Product Overview : Human EPGN full-length ORF ( AAI46548.1, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
Molecular Mass : 41.58 kDa
AA Sequence : MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRYEKDKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EPGN epithelial mitogen homolog (mouse) [ Homo sapiens ]
Official Symbol EPGN
Synonyms EPGN; epithelial mitogen homolog (mouse); epigen; ALGV3072; EPG; PRO9904; FLJ75542;
Gene ID 255324
mRNA Refseq NM_001013442
Protein Refseq NP_001013460
UniProt ID Q6UW88

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPGN Products

Required fields are marked with *

My Review for All EPGN Products

Required fields are marked with *

0
cart-icon