Recombinant Human EPHA4 protein, GST-tagged
Cat.No. : | EPHA4-3636H |
Product Overview : | Recombinant Human EPHA4 protein(904-986 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 904-986 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | DPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQMQQMHGRMVPV |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | EPHA4 EPH receptor A4 [ Homo sapiens ] |
Official Symbol | EPHA4 |
Synonyms | EPHA4; EPH receptor A4; EphA4 , TYRO1; ephrin type-A receptor 4; Hek8; EK8; EPH-like kinase 8; TYRO1 protein tyrosine kinase; tyrosine-protein kinase TYRO1; tyrosine-protein kinase receptor SEK; receptor protein-tyrosine kinase HEK8; SEK; HEK8; TYRO1; |
mRNA Refseq | NM_004438 |
Protein Refseq | NP_004429 |
MIM | 602188 |
UniProt ID | P54764 |
Gene ID | 2043 |
◆ Recombinant Proteins | ||
EPHA4-26439TH | Recombinant Human EPHA4 | +Inquiry |
EPHA4-942H | Active Recombinant Human EPHA4 protein(Met1-Thr547), His&hFc-tagged | +Inquiry |
EPHA4-0977H | Recombinant Human EPHA4 Protein (E252-V986), Tag Free | +Inquiry |
Epha4-10543M | Recombinant Mouse Epha4 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPHA4-3384H | Active Recombinant Human EPHA4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHA4-1446RCL | Recombinant Rat EPHA4 cell lysate | +Inquiry |
EPHA4-2136MCL | Recombinant Mouse EPHA4 cell lysate | +Inquiry |
EPHA4-1192CCL | Recombinant Cynomolgus EPHA4 cell lysate | +Inquiry |
EPHA4-001HCL | Recombinant Human EPHA4 cell lysate | +Inquiry |
EPHA4-1933HCL | Recombinant Human EPHA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPHA4 Products
Required fields are marked with *
My Review for All EPHA4 Products
Required fields are marked with *