Recombinant Human EPHA4 protein, His-tagged
| Cat.No. : | EPHA4-3087H |
| Product Overview : | Recombinant Human EPHA4 protein(904-986 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 23, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 904-986 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | DPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQMQQMHGRMVPV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | EPHA4 EPH receptor A4 [ Homo sapiens ] |
| Official Symbol | EPHA4 |
| Synonyms | EPHA4; EPH receptor A4; EphA4 , TYRO1; ephrin type-A receptor 4; Hek8; EK8; EPH-like kinase 8; TYRO1 protein tyrosine kinase; tyrosine-protein kinase TYRO1; tyrosine-protein kinase receptor SEK; receptor protein-tyrosine kinase HEK8; SEK; HEK8; TYRO1; |
| Gene ID | 2043 |
| mRNA Refseq | NM_004438 |
| Protein Refseq | NP_004429 |
| MIM | 602188 |
| UniProt ID | P54764 |
| ◆ Recombinant Proteins | ||
| EPHA4-942H | Active Recombinant Human EPHA4 protein(Met1-Thr547), His&hFc-tagged | +Inquiry |
| EPHA4-550H | Active Recombinant Human EPHA4 Protein, Fc Chimera | +Inquiry |
| EPHA4-67H | Recombinant Human EPHA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EphA4-1402H | Active Recombinant Human EphA4 protein, His-tagged | +Inquiry |
| EPHA4-366H | Recombinant Human EPHA4 Protein, DDK/His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPHA4-1446RCL | Recombinant Rat EPHA4 cell lysate | +Inquiry |
| EPHA4-1192CCL | Recombinant Cynomolgus EPHA4 cell lysate | +Inquiry |
| EPHA4-1933HCL | Recombinant Human EPHA4 cell lysate | +Inquiry |
| EPHA4-2136MCL | Recombinant Mouse EPHA4 cell lysate | +Inquiry |
| EPHA4-001HCL | Recombinant Human EPHA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPHA4 Products
Required fields are marked with *
My Review for All EPHA4 Products
Required fields are marked with *
