Recombinant Human EPHA4 protein, His-tagged

Cat.No. : EPHA4-3087H
Product Overview : Recombinant Human EPHA4 protein(904-986 aa), fused to His tag, was expressed in E. coli.
Availability June 26, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 904-986 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : DPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQMQQMHGRMVPV
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name EPHA4 EPH receptor A4 [ Homo sapiens ]
Official Symbol EPHA4
Synonyms EPHA4; EPH receptor A4; EphA4 , TYRO1; ephrin type-A receptor 4; Hek8; EK8; EPH-like kinase 8; TYRO1 protein tyrosine kinase; tyrosine-protein kinase TYRO1; tyrosine-protein kinase receptor SEK; receptor protein-tyrosine kinase HEK8; SEK; HEK8; TYRO1;
Gene ID 2043
mRNA Refseq NM_004438
Protein Refseq NP_004429
MIM 602188
UniProt ID P54764

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPHA4 Products

Required fields are marked with *

My Review for All EPHA4 Products

Required fields are marked with *

0
cart-icon
0
compare icon