Recombinant Human EPHA5 Protein, GST-tagged
| Cat.No. : | EPHA5-3390H |
| Product Overview : | Human EPHA5 partial ORF ( NP_004430, 234 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EPHA5 EPH receptor A5 [ Homo sapiens ] |
| Official Symbol | EPHA5 |
| Synonyms | EPHA5; EPH receptor A5; EphA5; ephrin type-A receptor 5; CEK7; EHK1; Hek7; TYRO4; EK7; EHK-1; EPH-like kinase 7; EPH homology kinase 1; Eph homology kinase-1; brain-specific kinase; receptor protein-tyrosine kinase HEK7; tyrosine-protein kinase receptor EHK-1; HEK7; |
| Gene ID | 2044 |
| mRNA Refseq | NM_004439 |
| Protein Refseq | NP_004430 |
| MIM | 600004 |
| UniProt ID | P54756 |
| ◆ Recombinant Proteins | ||
| Epha5-6381R | Recombinant Rat Epha5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EPHA5-696H | Recombinant Human EPH Receptor A5, GST-tagged | +Inquiry |
| Epha5-457M | Active Recombinant Mouse Eph Receptor A5, His-tagged | +Inquiry |
| EPHA5-368H | Recombinant Human EPHA5 Protein, DDK-tagged | +Inquiry |
| Epha5-503R | Recombinant Rat EphA5 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPHA5 Products
Required fields are marked with *
My Review for All EPHA5 Products
Required fields are marked with *
