Recombinant Human EPHA5 Protein, GST-tagged

Cat.No. : EPHA5-3390H
Product Overview : Human EPHA5 partial ORF ( NP_004430, 234 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013]
Molecular Mass : 36.63 kDa
AA Sequence : PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRPGFFKASPHIQSCGKCPPHSYTHEEAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EPHA5 EPH receptor A5 [ Homo sapiens ]
Official Symbol EPHA5
Synonyms EPHA5; EPH receptor A5; EphA5; ephrin type-A receptor 5; CEK7; EHK1; Hek7; TYRO4; EK7; EHK-1; EPH-like kinase 7; EPH homology kinase 1; Eph homology kinase-1; brain-specific kinase; receptor protein-tyrosine kinase HEK7; tyrosine-protein kinase receptor EHK-1; HEK7;
Gene ID 2044
mRNA Refseq NM_004439
Protein Refseq NP_004430
MIM 600004
UniProt ID P54756

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPHA5 Products

Required fields are marked with *

My Review for All EPHA5 Products

Required fields are marked with *

0
cart-icon
0
compare icon