Recombinant Human EPHB2 protein, His-tagged
Cat.No. : | EPHB2-3690H |
Product Overview : | Recombinant Human EPHB2 protein(886-986 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 886-986 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EPHB2 EPH receptor B2 [ Homo sapiens ] |
Official Symbol | EPHB2 |
Synonyms | EPHB2; EPH receptor B2; DRT, EphB2 , EPHT3, ERK; ephrin type-B receptor 2; Hek5; Tyro5; EPH-like kinase 5; eph tyrosine kinase 3; elk-related tyrosine kinase; protein-tyrosine kinase HEK5; tyrosine-protein kinase TYRO5; renal carcinoma antigen NY-REN-47; tyrosine-protein kinase receptor EPH-3; developmentally-regulated Eph-related tyrosine kinase; DRT; EK5; ERK; CAPB; PCBC; EPHT3; MGC87492; |
Gene ID | 2048 |
mRNA Refseq | NM_004442 |
Protein Refseq | NP_004433 |
MIM | 600997 |
UniProt ID | P29323 |
◆ Recombinant Proteins | ||
EPHB2-3690H | Recombinant Human EPHB2 protein, His-tagged | +Inquiry |
EPHB2-7299H | Active Recombinant Human EPHB2 protein(Gly570-Val987), His&GST-tagged | +Inquiry |
EPHB2-3400H | Recombinant Human EPHB2 Protein, GST-tagged | +Inquiry |
EPHB2-0990H | Recombinant Human EPHB2 Protein (L581-G1055), GST tagged | +Inquiry |
EPHB2-3273H | Recombinant Human EPHB2 Protein (Val19-Ser482), C-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHB2-1106HCL | Recombinant Human EPHB2 cell lysate | +Inquiry |
EPHB2-001MCL | Recombinant Mouse EPHB2 cell lysate | +Inquiry |
EPHB2-001HCL | Recombinant Human EPHB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPHB2 Products
Required fields are marked with *
My Review for All EPHB2 Products
Required fields are marked with *
0
Inquiry Basket