Recombinant Human EPHB2 protein, His-tagged

Cat.No. : EPHB2-3690H
Product Overview : Recombinant Human EPHB2 protein(886-986 aa), fused to His tag, was expressed in E. coli.
Availability August 31, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 886-986 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name EPHB2 EPH receptor B2 [ Homo sapiens ]
Official Symbol EPHB2
Synonyms EPHB2; EPH receptor B2; DRT, EphB2 , EPHT3, ERK; ephrin type-B receptor 2; Hek5; Tyro5; EPH-like kinase 5; eph tyrosine kinase 3; elk-related tyrosine kinase; protein-tyrosine kinase HEK5; tyrosine-protein kinase TYRO5; renal carcinoma antigen NY-REN-47; tyrosine-protein kinase receptor EPH-3; developmentally-regulated Eph-related tyrosine kinase; DRT; EK5; ERK; CAPB; PCBC; EPHT3; MGC87492;
Gene ID 2048
mRNA Refseq NM_004442
Protein Refseq NP_004433
MIM 600997
UniProt ID P29323

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPHB2 Products

Required fields are marked with *

My Review for All EPHB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon