Recombinant Human EPN2 protein, His-tagged
| Cat.No. : | EPN2-7443H |
| Product Overview : | Recombinant Human EPN2 protein(252-448 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 252-448 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | LEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATAQSVPKNSDPWAASQQPASSAGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPFESQPLTVASSKPSSA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | EPN2 epsin 2 [ Homo sapiens ] |
| Official Symbol | EPN2 |
| Synonyms | EPN2; epsin 2; epsin-2; EHB21; Eps15 binding protein; KIAA1065; EPS-15-interacting protein 2; |
| Gene ID | 22905 |
| mRNA Refseq | NM_001102664 |
| Protein Refseq | NP_001096134 |
| MIM | 607263 |
| UniProt ID | O95208 |
| ◆ Recombinant Proteins | ||
| EPN2-3912H | Recombinant Human EPN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| EPN2-4393HF | Recombinant Full Length Human EPN2 Protein, GST-tagged | +Inquiry |
| Epn2-963M | Recombinant Mouse Epn2 Protein, MYC/DDK-tagged | +Inquiry |
| EPN2-2017C | Recombinant Chicken EPN2 | +Inquiry |
| EPN2-3417H | Recombinant Human EPN2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPN2-6580HCL | Recombinant Human EPN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPN2 Products
Required fields are marked with *
My Review for All EPN2 Products
Required fields are marked with *



