Recombinant Full Length Human EPN2 Protein, GST-tagged
Cat.No. : | EPN2-4393HF |
Product Overview : | Human EPN2 full-length ORF (BAG51000.1, 1 a.a. - 584 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 584 amino acids |
Description : | This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 88.7 kDa |
AA Sequence : | MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATAQSVPKNSDPWAASQQPASSAGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFLAPGAPATSAPVNPFQVNQPQPLTLNQLRGSPVLGTSTSFGPGPGVESMAVASMTSAAPQPALGATGSSLTPLGPAMMNMVGSVGIPPSAAQATGTTNPFLL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EPN2 epsin 2 [ Homo sapiens ] |
Official Symbol | EPN2 |
Synonyms | EPN2; epsin 2; epsin-2; EHB21; Eps15 binding protein; KIAA1065; EPS-15-interacting protein 2; |
Gene ID | 22905 |
mRNA Refseq | NM_001102664 |
Protein Refseq | NP_001096134 |
MIM | 607263 |
UniProt ID | O95208 |
◆ Recombinant Proteins | ||
EPN2-4393HF | Recombinant Full Length Human EPN2 Protein, GST-tagged | +Inquiry |
Epn2-963M | Recombinant Mouse Epn2 Protein, MYC/DDK-tagged | +Inquiry |
EPN2-3417H | Recombinant Human EPN2 Protein, GST-tagged | +Inquiry |
EPN2-7443H | Recombinant Human EPN2 protein, His-tagged | +Inquiry |
EPN2-2017C | Recombinant Chicken EPN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPN2-6580HCL | Recombinant Human EPN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPN2 Products
Required fields are marked with *
My Review for All EPN2 Products
Required fields are marked with *