Recombinant Human EPPK1 Protein (1-225 aa), His-tagged
| Cat.No. : | EPPK1-486H |
| Product Overview : | Recombinant Human EPPK1 Protein (1-225 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-225 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 27.5 kDa |
| AA Sequence : | MSGHTLPPLPVPGTNSTEQASVPRAMAATLGAGTPPRPQARSIAGVYVEASGQAQSVYAAMEQGLLPAGLGQALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAERATTGYPDPYGGEKLALFQAIGKEVVDRALGQSWLEVQLATGGLVDPAQGVLVAPEPACHQGLLDRETWHKLSELEPGTGDLRFLNPNTLERLTYHQLLERCVRAPGSG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | EPPK1 epiplakin 1 [ Homo sapiens (human) ] |
| Official Symbol | EPPK1 |
| Synonyms | EPIPL; EPIPL1; |
| Gene ID | 83481 |
| mRNA Refseq | NM_031308 |
| Protein Refseq | NP_112598 |
| UniProt ID | P58107 |
| ◆ Recombinant Proteins | ||
| EPPK1-2825M | Recombinant Mouse EPPK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EPPK1-486H | Recombinant Human EPPK1 Protein (1-225 aa), His-tagged | +Inquiry |
| EPPK1-5263M | Recombinant Mouse EPPK1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPPK1 Products
Required fields are marked with *
My Review for All EPPK1 Products
Required fields are marked with *
