Recombinant Human EPPK1 Protein (1-225 aa), His-tagged

Cat.No. : EPPK1-486H
Product Overview : Recombinant Human EPPK1 Protein (1-225 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-225 aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 27.5 kDa
AA Sequence : MSGHTLPPLPVPGTNSTEQASVPRAMAATLGAGTPPRPQARSIAGVYVEASGQAQSVYAAMEQGLLPAGLGQALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAERATTGYPDPYGGEKLALFQAIGKEVVDRALGQSWLEVQLATGGLVDPAQGVLVAPEPACHQGLLDRETWHKLSELEPGTGDLRFLNPNTLERLTYHQLLERCVRAPGSG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name EPPK1 epiplakin 1 [ Homo sapiens (human) ]
Official Symbol EPPK1
Synonyms EPIPL; EPIPL1;
Gene ID 83481
mRNA Refseq NM_031308
Protein Refseq NP_112598
UniProt ID P58107

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPPK1 Products

Required fields are marked with *

My Review for All EPPK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon