Recombinant Human EPS15 protein(657-798aa), His-tagged
Cat.No. : | EPS15-653H |
Product Overview : | Recombinant Human EPS15 protein(P42566)(657-798aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 657-798aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD |
Gene Name | EPS15 epidermal growth factor receptor pathway substrate 15 [ Homo sapiens ] |
Official Symbol | EPS15 |
Synonyms | EPS15; epidermal growth factor receptor pathway substrate 15; epidermal growth factor receptor substrate 15; AF 1P; MLLT5; protein AF-1p; ALL1 fused gene from chromosome 1; AF1P; AF-1P; |
Gene ID | 2060 |
mRNA Refseq | NM_001159969 |
Protein Refseq | NP_001153441 |
MIM | 600051 |
UniProt ID | P42566 |
◆ Recombinant Proteins | ||
EPS15-2827M | Recombinant Mouse EPS15 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPS15-5265M | Recombinant Mouse EPS15 Protein | +Inquiry |
Eps15-965M | Recombinant Mouse Eps15 Protein, MYC/DDK-tagged | +Inquiry |
EPS15-653H | Recombinant Human EPS15 protein(657-798aa), His-tagged | +Inquiry |
EPS15-2722H | Recombinant Human EPS15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPS15-6578HCL | Recombinant Human EPS15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPS15 Products
Required fields are marked with *
My Review for All EPS15 Products
Required fields are marked with *