Recombinant Human EPS8 Protein, GST-tagged
| Cat.No. : | EPS8-3426H |
| Product Overview : | Human EPS8 full-length ORF ( NP_004438.3, 1 a.a. - 822 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined. Highly similar proteins in other organisms are involved in the transduction of signals from Ras to Rac and growth factor-mediated actin remodeling. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 118.3 kDa |
| AA Sequence : | MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQNPSAADLVHFLFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEWPKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPPYTHTIQKQRMEYGPRPADTPPAPSPPPTPAPVPVPLPPSTPAPVPVSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQKAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EPS8 epidermal growth factor receptor pathway substrate 8 [ Homo sapiens ] |
| Official Symbol | EPS8 |
| Synonyms | EPS8; epidermal growth factor receptor pathway substrate 8; epidermal growth factor receptor kinase substrate 8; |
| Gene ID | 2059 |
| mRNA Refseq | NM_004447 |
| Protein Refseq | NP_004438 |
| MIM | 600206 |
| UniProt ID | Q12929 |
| ◆ Recombinant Proteins | ||
| EPS8-3426H | Recombinant Human EPS8 Protein, GST-tagged | +Inquiry |
| EPS8-2876H | Recombinant Human EPS8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EPS8-1488R | Recombinant Rhesus monkey EPS8 Protein, His-tagged | +Inquiry |
| EPS8-1313R | Recombinant Rhesus Macaque EPS8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EPS8-4406HF | Recombinant Full Length Human EPS8 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPS8-6576HCL | Recombinant Human EPS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPS8 Products
Required fields are marked with *
My Review for All EPS8 Products
Required fields are marked with *
