Recombinant Human ERAP2 protein, His-tagged
Cat.No. : | ERAP2-3105H |
Product Overview : | Recombinant Human ERAP2 protein(41-180 aa), fused to His tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 41-180 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PSSYHFTEDPGAFPVATNGERFPWQELRLPSVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNATLQSEEDSRYMKPGKELKVLSYPAHEQIALLVPEKLTPHLKYYVAMDFQAKLGDGFEGFY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ERAP2 endoplasmic reticulum aminopeptidase 2 [ Homo sapiens ] |
Official Symbol | ERAP2 |
Synonyms | ERAP2; endoplasmic reticulum aminopeptidase 2; L RAP; leukocyte derived arginine aminopeptidase; LRAP; leukocyte-derived arginine aminopeptidase; L-RAP; FLJ23633; FLJ23701; FLJ23807; |
Gene ID | 64167 |
mRNA Refseq | NM_001130140 |
Protein Refseq | NP_001123612 |
MIM | 609497 |
UniProt ID | Q6P179 |
◆ Recombinant Proteins | ||
ERAP2-304H | Active Recombinant Human ERAP2, His tagged | +Inquiry |
ERAP2-3105H | Recombinant Human ERAP2 protein, His-tagged | +Inquiry |
ERAP2-483H | Recombinant Human ERAP2 Protein, His-tagged | +Inquiry |
ERAP2-6628Z | Recombinant Zebrafish ERAP2 | +Inquiry |
ERAP2-936H | Recombinant Human ERAP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERAP2-2777HCL | Recombinant Human ERAP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERAP2 Products
Required fields are marked with *
My Review for All ERAP2 Products
Required fields are marked with *