Recombinant Human ERBB3 Protein, GST-tagged
Cat.No. : | ERBB3-3448H |
Product Overview : | Human ERBB3 full-length ORF ( AAH02706, 21 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 59.95 kDa |
AA Sequence : | EVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ERBB3 v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) [ Homo sapiens ] |
Official Symbol | ERBB3 |
Synonyms | ERBB3; v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian); LCCS2, lethal congenital contracture syndrome 2; receptor tyrosine-protein kinase erbB-3; HER3; proto-oncogene-like protein c-ErbB-3; tyrosine kinase-type cell surface receptor HER3; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3; MGC88033; |
Gene ID | 2065 |
mRNA Refseq | NM_001005915 |
Protein Refseq | NP_001005915 |
MIM | 190151 |
UniProt ID | P21860 |
◆ Recombinant Proteins | ||
Erbb3-2515M | Recombinant Mouse Erbb3 protein(Met1-His641), His-tagged | +Inquiry |
ERBB3-7276HAF647 | Recombinant Human ERBB3 Protein, His/GST-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Erbb3-2515MF | Recombinant Mouse Erbb3 Protein, His-tagged, FITC conjugated | +Inquiry |
ERBB3-232H | Recombinant Human ERBB3, C13&N15-labeled | +Inquiry |
ErbB3-275HAF555 | Recombinant Human ERBB3 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERBB3-430HCL | Recombinant Human ERBB3 cell lysate | +Inquiry |
ERBB3-1721RCL | Recombinant Rhesus ERBB3 cell lysate | +Inquiry |
ERBB3-1765MCL | Recombinant Mouse ERBB3 cell lysate | +Inquiry |
ERBB3-1415RCL | Recombinant Rat ERBB3 cell lysate | +Inquiry |
ERBB3-939HCL | Recombinant Human ERBB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERBB3 Products
Required fields are marked with *
My Review for All ERBB3 Products
Required fields are marked with *
0
Inquiry Basket