Recombinant Human ERBB4 protein, GST-tagged
Cat.No. : | ERBB4-3768H |
Product Overview : | Recombinant Human ERBB4 protein(989-1308 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 989-1308 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | GDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ERBB4 v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian) [ Homo sapiens ] |
Official Symbol | ERBB4 |
Synonyms | ERBB4; v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian); v erb a avian erythroblastic leukemia viral oncogene homolog like 4; receptor tyrosine-protein kinase erbB-4; proto-oncogene-like protein c-ErbB-4; tyrosine kinase-type cell surface receptor HER4; avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4; HER4; p180erbB4; MGC138404; |
Gene ID | 2066 |
mRNA Refseq | NM_001042599 |
Protein Refseq | NP_001036064 |
MIM | 600543 |
UniProt ID | Q15303 |
◆ Recombinant Proteins | ||
ERBB4-3768H | Recombinant Human ERBB4 protein, GST-tagged | +Inquiry |
ERBB4-288H | Recombinant Human ERBB4, Fc-His tagged | +Inquiry |
ERBB4-288HAF647 | Recombinant Human ERBB4 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
ERBB4-1791R | Recombinant Rat ERBB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERBB4-2651H | Active Recombinant Human ERBB4 protein, hFc&His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERBB4-1543HCL | Recombinant Human ERBB4 cell lysate | +Inquiry |
ERBB4-001HCL | Recombinant Human ERBB4 cell lysate | +Inquiry |
ERBB4-1417MCL | Recombinant Mouse ERBB4 cell lysate | +Inquiry |
ERBB4-895RCL | Recombinant Rat ERBB4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERBB4 Products
Required fields are marked with *
My Review for All ERBB4 Products
Required fields are marked with *