Recombinant Human ERCC8
Cat.No. : | ERCC8-26850TH |
Product Overview : | Recombinant full length Human ERCC8 with N terminal proprietary tag, 69.56 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 396 amino acids |
Description : | This gene encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptionally active genes. |
Molecular Weight : | 69.560kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKDRDVER IHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQS YYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSF DKTLKVWDTNTLQTADVFNFEETVYSHHMSPVSTKHCLVA VGTRGPKVQLCDLKSGSCSHILQGHRQEILAVSWSPRYDY ILATASADSRVKLWDVRRASGCLITLDQHNGKKSQAVESA NTAHNGKVNGLCFTSDGLHLLTVGTDNRMRLWNSSNGENT LVNYGKVCNNSKKGLKFTVSCGCSSEFVFVPYGSTIAVYT VYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILA WVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG |
Sequence Similarities : | Contains 5 WD repeats. |
Gene Name | ERCC8 excision repair cross-complementing rodent repair deficiency, complementation group 8 [ Homo sapiens ] |
Official Symbol | ERCC8 |
Synonyms | ERCC8; excision repair cross-complementing rodent repair deficiency, complementation group 8; CKN1, Cockayne syndrome 1 (classical); DNA excision repair protein ERCC-8; CSA; |
Gene ID | 1161 |
mRNA Refseq | NM_000082 |
Protein Refseq | NP_000073 |
MIM | 609412 |
Uniprot ID | Q13216 |
Chromosome Location | 5q12.1 |
Pathway | Cul4-DDB1-CSA complex, organism-specific biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; Formation of transcription-coupled NER (TC-NER) repair complex, organism-specific biosystem; Nucleotide Excision Repair, organism-specific biosystem; |
Function | NOT DNA helicase activity; NOT DNA-dependent ATPase activity; protein binding; protein complex binding; contributes_to ubiquitin-protein ligase activity; |
◆ Recombinant Proteins | ||
ERCC8-1509Z | Recombinant Zebrafish ERCC8 | +Inquiry |
ERCC8-1436H | Recombinant Human ERCC8 Protein, His&GST-tagged | +Inquiry |
Ercc8-1437M | Recombinant Mouse Ercc8 Protein, His&GST-tagged | +Inquiry |
ERCC8-26850TH | Recombinant Human ERCC8 | +Inquiry |
ERCC8-5291M | Recombinant Mouse ERCC8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERCC8-6562HCL | Recombinant Human ERCC8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERCC8 Products
Required fields are marked with *
My Review for All ERCC8 Products
Required fields are marked with *