Recombinant Human ERF protein, His-tagged
Cat.No. : | ERF-2676H |
Product Overview : | Recombinant Human ERF protein(138-323 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 138-323 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GGSHFRFPPSTPSEVLSPTEDPRSPPACSSSSSSLFSAVVARRLGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSGGGGPSGSGGGSHFSFSPEDMKRYLQAHTQSVYN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ERF Ets2 repressor factor [ Homo sapiens ] |
Official Symbol | ERF |
Synonyms | ERF; Ets2 repressor factor; ETS domain-containing transcription factor ERF; PE 2; PE2; PE-2; |
Gene ID | 2077 |
mRNA Refseq | NM_006494 |
Protein Refseq | NP_006485 |
MIM | 611888 |
UniProt ID | P50548 |
◆ Recombinant Proteins | ||
ERF-2846M | Recombinant Mouse ERF Protein, His (Fc)-Avi-tagged | +Inquiry |
ERF-4028Z | Recombinant Zebrafish ERF | +Inquiry |
ERF-2676H | Recombinant Human ERF protein, His-tagged | +Inquiry |
ERF-3467H | Recombinant Human ERF Protein, GST-tagged | +Inquiry |
ERF-5294M | Recombinant Mouse ERF Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERF-6561HCL | Recombinant Human ERF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERF Products
Required fields are marked with *
My Review for All ERF Products
Required fields are marked with *
0
Inquiry Basket