Recombinant Human ERG, GST-tagged
Cat.No. : | ERG-28690TH |
Product Overview : | Recombinant Human ERG(1 a.a. - 100 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Flag&His |
Description : | This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apoptosis. The protein encoded by this gene is mainly expressed in the nucleus. It contains an ETS DNA-binding domain and a PNT (pointed) domain which is implicated in the self-association of chimeric oncoproteins. This protein is required for platelet adhesion to the subendothelium, inducing vascular cell remodeling. It also regulates hematopoesis, and the differentiation and maturation of megakaryocytic cells. This gene is involved in chromosomal translocations, resulting in different fusion gene products, such as TMPSSR2-ERG and NDRG1-ERG in prostate cancer, EWS-ERG in Ewing's sarcoma and FUS-ERG in acute myeloid leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQV NGSRNSPDECSVAKGGKMVGSPDTV |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ERG v-ets avian erythroblastosis virus E26 oncogene homolog [ Homo sapiens (human) ] |
Official Symbol | ERG |
Synonyms | ERG; p55; erg-3; v-ets avian erythroblastosis virus E26 oncogene homolog; transcriptional regulator ERG; ets-related; TMPRSS2/ERG fusion; v-ets erythroblastosis virus E26 oncogene like; v-ets erythroblastosis virus E26 oncogene homolog; v-ets avian erythroblastosis virus E26 oncogene related; transcriptional regulator ERG (transforming protein ERG) |
Gene ID | 2078 |
mRNA Refseq | NM_182918 |
Protein Refseq | NP_891548 |
MIM | 165080 |
UniProt ID | P11308 |
Chromosome Location | 21q22.3 |
Pathway | Prostate Cancer; Transcriptional misregulation in cancer |
Function | DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity |
◆ Recombinant Proteins | ||
ERG-1389H | Recombinant Human ERG Protein (1-486 aa), His-tagged | +Inquiry |
ERG-5697H | Recombinant Human ERG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ERG-5215H | Recombinant Human ERG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ERG-226H | Recombinant Human ERG protein, His-SUMO-tagged | +Inquiry |
ERG-5853C | Recombinant Chicken ERG | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERG-6560HCL | Recombinant Human ERG 293 Cell Lysate | +Inquiry |
ERG-6559HCL | Recombinant Human ERG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERG Products
Required fields are marked with *
My Review for All ERG Products
Required fields are marked with *