Recombinant Human ERH, His-tagged

• Cat.No.: ERH-28693TH
• Product Overview: Recombinant full length Human ERH with an N terminal His tag; 127 amino acids with tag, MWt 14.6 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 104 amino acids
• Description: Enhancer of rudimentary homolog is a protein that in humans is encoded by the ERH gene.
• Conjugation: HIS
• Molecular Weight: 14.600kDa inclusive of tags
• Tissue specificity: Expressed in all tissues examined.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
• Sequence Similarities: Belongs to the E(R) family.

Gene Information

• Gene Name: ERH enhancer of rudimentary homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: ERH
• Synonyms: ERH; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog; DROER
• Gene ID: 2079
• mRNA Refseq: NM_004450
• Protein Refseq: NP_004441
• MIM: 601191
• Uniprot ID: P84090
• Chromosome Location: 14q24.1