Recombinant Human ERH, His-tagged

Cat.No. : ERH-28693TH
Product Overview : Recombinant full length Human ERH with an N terminal His tag; 127 amino acids with tag, MWt 14.6 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 104 amino acids
Description : Enhancer of rudimentary homolog is a protein that in humans is encoded by the ERH gene.
Conjugation : HIS
Molecular Weight : 14.600kDa inclusive of tags
Tissue specificity : Expressed in all tissues examined.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Sequence Similarities : Belongs to the E(R) family.
Gene Name ERH enhancer of rudimentary homolog (Drosophila) [ Homo sapiens ]
Official Symbol ERH
Synonyms ERH; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog; DROER;
Gene ID 2079
mRNA Refseq NM_004450
Protein Refseq NP_004441
MIM 601191
Uniprot ID P84090
Chromosome Location 14q24.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERH Products

Required fields are marked with *

My Review for All ERH Products

Required fields are marked with *

0
cart-icon
0
compare icon