Recombinant Human ERN2 protein, His-tagged

Cat.No. : ERN2-3638H
Product Overview : Recombinant Human ERN2 protein(452-563 aa), fused to His tag, was expressed in E. coli.
Availability December 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 452-563 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : SLSREKLWDSELHPEEKTPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRSQKRLQSPSKQAQPLDDPEAEQLTVV
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ERN2 endoplasmic reticulum to nucleus signaling 2 [ Homo sapiens ]
Official Symbol ERN2
Synonyms ERN2; endoplasmic reticulum to nucleus signaling 2; ER to nucleus signalling 2; serine/threonine-protein kinase/endoribonuclease IRE2; IRE1b; hIRE2p; IRE1 beta; inositol-requiring 1 beta; inositol-requiring protein 2; IRE1, S. cerevisiae, homolog of; endoplasmic reticulum-to-nucleus signaling 2; endoplasmic reticulum to nucleus signalling 2; IRE1-BETA;
Gene ID 10595
mRNA Refseq NM_033266
Protein Refseq NP_150296
MIM 604034
UniProt ID Q76MJ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERN2 Products

Required fields are marked with *

My Review for All ERN2 Products

Required fields are marked with *

0
cart-icon
0
compare icon