Recombinant Human ERN2 protein, His-tagged
Cat.No. : | ERN2-3638H |
Product Overview : | Recombinant Human ERN2 protein(452-563 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 452-563 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SLSREKLWDSELHPEEKTPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRSQKRLQSPSKQAQPLDDPEAEQLTVV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ERN2 endoplasmic reticulum to nucleus signaling 2 [ Homo sapiens ] |
Official Symbol | ERN2 |
Synonyms | ERN2; endoplasmic reticulum to nucleus signaling 2; ER to nucleus signalling 2; serine/threonine-protein kinase/endoribonuclease IRE2; IRE1b; hIRE2p; IRE1 beta; inositol-requiring 1 beta; inositol-requiring protein 2; IRE1, S. cerevisiae, homolog of; endoplasmic reticulum-to-nucleus signaling 2; endoplasmic reticulum to nucleus signalling 2; IRE1-BETA; |
Gene ID | 10595 |
mRNA Refseq | NM_033266 |
Protein Refseq | NP_150296 |
MIM | 604034 |
UniProt ID | Q76MJ5 |
◆ Recombinant Proteins | ||
ERN2-676H | Recombinant Human ERN2 | +Inquiry |
ERN2-6754H | Recombinant Human ERN2 protein, GST-tagged | +Inquiry |
ERN2-2883H | Recombinant Human ERN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERN2-3638H | Recombinant Human ERN2 protein, His-tagged | +Inquiry |
ERN2-89H | Active Recombinant Human ERN2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERN2-6547HCL | Recombinant Human ERN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERN2 Products
Required fields are marked with *
My Review for All ERN2 Products
Required fields are marked with *
0
Inquiry Basket