Recombinant Human ERP29 Protein, GST-tagged
| Cat.No. : | ERP29-3489H | 
| Product Overview : | Human ERP29 full-length ORF ( NP_006808.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016] | 
| Molecular Mass : | 55.4 kDa | 
| AA Sequence : | MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array  | 
                                
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | ERP29 endoplasmic reticulum protein 29 [ Homo sapiens ] | 
| Official Symbol | ERP29 | 
| Synonyms | ERP29; endoplasmic reticulum protein 29; C12orf8, chromosome 12 open reading frame 8; endoplasmic reticulum resident protein 29; ERp28; ERp29; ERp31; PDI DB; PDIA9; protein disulfide isomerase family A; member 9; endoplasmic reticulum resident protein 28; endoplasmic reticulum resident protein 31; endoplasmic reticulum lumenal protein ERp28; protein disulfide isomerase family A, member 9; PDI-DB; C12orf8; | 
| Gene ID | 10961 | 
| mRNA Refseq | NM_001034025 | 
| Protein Refseq | NP_001029197 | 
| MIM | 602287 | 
| UniProt ID | P30040 | 
| ◆ Recombinant Proteins | ||
| ERP29-866H | Recombinant Human ERP29 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ERP29-3489H | Recombinant Human ERP29 Protein, GST-tagged | +Inquiry | 
| ERP29-1497R | Recombinant Rhesus monkey ERP29 Protein, His-tagged | +Inquiry | 
| ERP29-1492HFL | Recombinant Full Length Human ERP29 Protein, C-Flag-tagged | +Inquiry | 
| Erp29-702M | Recombinant Mouse Erp29 Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ERP29-6544HCL | Recombinant Human ERP29 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ERP29 Products
Required fields are marked with *
My Review for All ERP29 Products
Required fields are marked with *
  
        
    
      
            