Recombinant Human ERP44, His-tagged

Cat.No. : ERP44-30129TH
Product Overview : Recombinant full length Human TXNDC4 with an N terminal His tag; 415 amino acids, MWt 48 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 377 amino acids
Description : ERP44 is a novel endoplasmic reticulum chaperone involved in thiol-dependent retention of the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif.
Conjugation : HIS
Molecular Weight : 48.000kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWAGSMEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
Sequence Similarities : Contains 1 thioredoxin domain.
Gene Name ERP44 endoplasmic reticulum protein 44 [ Homo sapiens ]
Official Symbol ERP44
Synonyms ERP44; endoplasmic reticulum protein 44; thioredoxin domain containing 4 (endoplasmic reticulum) , TXNDC4; endoplasmic reticulum resident protein 44; KIAA0573; PDIA10; protein disulfide isomerase family A; member 10;
Gene ID 23071
mRNA Refseq NM_015051
Protein Refseq NP_055866
MIM 609170
Uniprot ID Q9BS26
Chromosome Location 9q22.33
Function protein disulfide isomerase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERP44 Products

Required fields are marked with *

My Review for All ERP44 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon