Recombinant Human ESCO1 Protein, GST-tagged
Cat.No. : | ESCO1-3496H |
Product Overview : | Human ESCO1 full-length ORF ( AAH36943.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ESCO1 belongs to a conserved family of acetyltransferases involved in sister chromatid cohesion (Hou and Zou, 2005 [PubMed 15958495]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 46.3 kDa |
AA Sequence : | MVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVGCLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRRKKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ESCO1 establishment of cohesion 1 homolog 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ESCO1 |
Synonyms | ESCO1; establishment of cohesion 1 homolog 1 (S. cerevisiae); N-acetyltransferase ESCO1; EFO1; ESO1; KIAA1911; EFO1p; hEFO1; CTF7 homolog 1; ECO1 homolog 1; ESO1 homolog 1; establishment factor-like protein 1; CTF; ECO1; A930014I12Rik; MGC105022; |
Gene ID | 114799 |
mRNA Refseq | NM_052911 |
Protein Refseq | NP_443143 |
MIM | 609674 |
UniProt ID | Q5FWF5 |
◆ Recombinant Proteins | ||
ESCO1-4698HF | Recombinant Full Length Human ESCO1 Protein, GST-tagged | +Inquiry |
ESCO1-2861M | Recombinant Mouse ESCO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ESCO1-5318M | Recombinant Mouse ESCO1 Protein | +Inquiry |
ESCO1-3496H | Recombinant Human ESCO1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESCO1-572HCL | Recombinant Human ESCO1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESCO1 Products
Required fields are marked with *
My Review for All ESCO1 Products
Required fields are marked with *