Recombinant Human ESCO1 Protein, GST-tagged

Cat.No. : ESCO1-3496H
Product Overview : Human ESCO1 full-length ORF ( AAH36943.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ESCO1 belongs to a conserved family of acetyltransferases involved in sister chromatid cohesion (Hou and Zou, 2005 [PubMed 15958495]).[supplied by OMIM, Mar 2008]
Molecular Mass : 46.3 kDa
AA Sequence : MVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVGCLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRRKKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ESCO1 establishment of cohesion 1 homolog 1 (S. cerevisiae) [ Homo sapiens ]
Official Symbol ESCO1
Synonyms ESCO1; establishment of cohesion 1 homolog 1 (S. cerevisiae); N-acetyltransferase ESCO1; EFO1; ESO1; KIAA1911; EFO1p; hEFO1; CTF7 homolog 1; ECO1 homolog 1; ESO1 homolog 1; establishment factor-like protein 1; CTF; ECO1; A930014I12Rik; MGC105022;
Gene ID 114799
mRNA Refseq NM_052911
Protein Refseq NP_443143
MIM 609674
UniProt ID Q5FWF5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ESCO1 Products

Required fields are marked with *

My Review for All ESCO1 Products

Required fields are marked with *

0
cart-icon
0
compare icon