Recombinant Human ESCO2 Protein, GST-tagged
Cat.No. : | ESCO2-3497H |
Product Overview : | Human ESCO2 full-length ORF ( AAI46563.1, 1 a.a. - 601 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that may have acetyltransferase activity and may be required for the establishment of sister chromatid cohesion during the S phase of mitosis. Mutations in this gene have been associated with Roberts syndrome. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 93.06 kDa |
AA Sequence : | MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGSPFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFPIVTEKMQGKPVCSKKNNKKPQKSLTAKYQPKYRHIKPVSRNSRNSKQNRVIYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLRKSSLENEPSLGRTQKSKSEVIEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSKNKEKLIKDSSDDRVSSKEHKVDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNFMKQTNIQKNTNTRDTSKKTKDQLIIDAGQKHFGATVCKSCGMIYTASNPEDEMQHVQHHHRFLEGIKYVGWKKERVVAEFWDGKIVLVLPHDPSFAIKKVEDVQELVDNELGFQQVVPKCPNKIKTFLFISDEKRVVGCLIAEPIKQAFRVLSEPIGPESPSSTECPRAWQCSDVPEPAVCGISRIWVFRLKRRKRIARRLVDTLRNCFMFGCFLSTDEIAFSDPTPDGKLFATKYCNTPNFLVYNFNS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ESCO2 establishment of cohesion 1 homolog 2 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ESCO2 |
Synonyms | ESCO2; establishment of cohesion 1 homolog 2 (S. cerevisiae); RBS, Roberts syndrome; N-acetyltransferase ESCO2; EFO2; ECO1 homolog 2; RBS; 2410004I17Rik; |
Gene ID | 157570 |
mRNA Refseq | NM_001017420 |
Protein Refseq | NP_001017420 |
MIM | 609353 |
UniProt ID | Q56NI9 |
◆ Recombinant Proteins | ||
ESCO2-4699HF | Recombinant Full Length Human ESCO2 Protein, GST-tagged | +Inquiry |
ESCO2-2862M | Recombinant Mouse ESCO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ESCO2-1159Z | Recombinant Zebrafish ESCO2 | +Inquiry |
ESCO2-3497H | Recombinant Human ESCO2 Protein, GST-tagged | +Inquiry |
ESCO2-01H | Recombinant Human ESCO2, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESCO2 Products
Required fields are marked with *
My Review for All ESCO2 Products
Required fields are marked with *
0
Inquiry Basket