Recombinant Human ESCO2, GST-tagged
| Cat.No. : | ESCO2-01H |
| Product Overview : | Recombinant human ESCO2 protein, fused to GST-tag, was expressed in E.coli and purified by using traditional GST-affinity column. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 2-352a.a. |
| Description : | This gene encodes a protein that may have acetyltransferase activity and may be required for the establishment of sister chromatid cohesion during the S phase of mitosis. Mutations in this gene have been associated with Roberts syndrome. |
| Molecular Mass : | 66kDa |
| AA Sequence : | MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGS PFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFPIVTEKMQGKPVCSKKNNKKPQKSLTAKYQP KYRHIKPVSRNSRNSKQNRVIYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLRKSSLE NEPSLGRTQKSKSEVIEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSKNKEKLIKDSSDDRVSSKEHK VDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNF |
| Applications : | SDS-PAGE |
| Gene Name | ESCO2 establishment of cohesion 1 homolog 2 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | ESCO2 |
| Synonyms | ESCO2; establishment of cohesion 1 homolog 2 (S. cerevisiae); RBS, Roberts syndrome; N-acetyltransferase ESCO2; EFO2; ECO1 homolog 2; RBS; 2410004I17Rik; |
| Gene ID | 157570 |
| mRNA Refseq | NM_001017420 |
| Protein Refseq | NP_001017420 |
| MIM | 609353 |
| UniProt ID | Q56NI9 |
| Chromosome Location | 8p21.1 |
| Function | metal ion binding; transferase activity, transferring acyl groups; |
| ◆ Recombinant Proteins | ||
| ESCO2-5319M | Recombinant Mouse ESCO2 Protein | +Inquiry |
| ESCO2-01H | Recombinant Human ESCO2, GST-tagged | +Inquiry |
| ESCO2-3497H | Recombinant Human ESCO2 Protein, GST-tagged | +Inquiry |
| ESCO2-2862M | Recombinant Mouse ESCO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ESCO2-4699HF | Recombinant Full Length Human ESCO2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESCO2 Products
Required fields are marked with *
My Review for All ESCO2 Products
Required fields are marked with *



