Recombinant Human ESCO2, GST-tagged
| Cat.No. : | ESCO2-01H | 
| Product Overview : | Recombinant human ESCO2 protein, fused to GST-tag, was expressed in E.coli and purified by using traditional GST-affinity column. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 2-352a.a. | 
| Description : | This gene encodes a protein that may have acetyltransferase activity and may be required for the establishment of sister chromatid cohesion during the S phase of mitosis. Mutations in this gene have been associated with Roberts syndrome. | 
| Molecular Mass : | 66kDa | 
| AA Sequence : | MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGS PFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFPIVTEKMQGKPVCSKKNNKKPQKSLTAKYQP KYRHIKPVSRNSRNSKQNRVIYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLRKSSLE NEPSLGRTQKSKSEVIEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSKNKEKLIKDSSDDRVSSKEHK VDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNF | 
| Applications : | SDS-PAGE | 
| Gene Name | ESCO2 establishment of cohesion 1 homolog 2 (S. cerevisiae) [ Homo sapiens ] | 
| Official Symbol | ESCO2 | 
| Synonyms | ESCO2; establishment of cohesion 1 homolog 2 (S. cerevisiae); RBS, Roberts syndrome; N-acetyltransferase ESCO2; EFO2; ECO1 homolog 2; RBS; 2410004I17Rik; | 
| Gene ID | 157570 | 
| mRNA Refseq | NM_001017420 | 
| Protein Refseq | NP_001017420 | 
| MIM | 609353 | 
| UniProt ID | Q56NI9 | 
| Chromosome Location | 8p21.1 | 
| Function | metal ion binding; transferase activity, transferring acyl groups; | 
| ◆ Recombinant Proteins | ||
| ESCO2-01H | Recombinant Human ESCO2, GST-tagged | +Inquiry | 
| ESCO2-1159Z | Recombinant Zebrafish ESCO2 | +Inquiry | 
| ESCO2-5319M | Recombinant Mouse ESCO2 Protein | +Inquiry | 
| ESCO2-3497H | Recombinant Human ESCO2 Protein, GST-tagged | +Inquiry | 
| ESCO2-4699HF | Recombinant Full Length Human ESCO2 Protein, GST-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ESCO2 Products
Required fields are marked with *
My Review for All ESCO2 Products
Required fields are marked with *
  
        
    
      
            