Recombinant Human ESR1 protein(191-270 aa), C-His-tagged
Cat.No. : | ESR1-2534H |
Product Overview : | Recombinant Human ESR1 protein(P03372)(191-270 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 191-270 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | YASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQ |
Gene Name | ESR1 estrogen receptor 1 [ Homo sapiens ] |
Official Symbol | ESR1 |
Synonyms | ESR1; estrogen receptor 1; ESR; estrogen receptor; Era; NR3A1; ER-alpha; estradiol receptor; estrogen nuclear receptor alpha; estrogen receptor alpha delta 4 +49 isoform; nuclear receptor subfamily 3 group A member 1; estrogen receptor alpha 3*,4,5,6,7*/822 isoform; estrogen receptor alpha delta 4*,5,6,7*/654 isoform; estrogen receptor alpha delta 4*,5,6,7,8*/901 isoform; estrogen receptor alpha delta 3*,4,5,6,7*/819-2 isoform; estrogen receptor alpha delta 3*,4,5,6,7*,8*/941 isoform; ER; ESRA; DKFZp686N23123; |
Gene ID | 2099 |
mRNA Refseq | NM_000125 |
Protein Refseq | NP_000116 |
UniProt ID | P03372 |
◆ Recombinant Proteins | ||
ESR1-28401TH | Recombinant Human ESR1 protein | +Inquiry |
ESR1-227H | Recombinant Human ESR1, StrepII-tagged | +Inquiry |
ESR1-356H | Recombinant Human ESR1 protein, His/MBP-tagged | +Inquiry |
ESR1-13HFL | Recombinant Human ESR1 Protein, Full Length, N-FLAG tagged | +Inquiry |
ESR1-14H | Recombinant Human ESR1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESR1-6540HCL | Recombinant Human ESR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESR1 Products
Required fields are marked with *
My Review for All ESR1 Products
Required fields are marked with *