Recombinant Human ESR1 protein, His-Myc-tagged
Cat.No. : | ESR1-5322H |
Product Overview : | Recombinant Human ESR1 protein(P03372)(315-551aa), fused with C-terminal His and Myc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 315-551aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHA |
Gene Name | ESR1 estrogen receptor 1 [ Homo sapiens ] |
Official Symbol | ESR1 |
Synonyms | ESR1; estrogen receptor 1; ESR; estrogen receptor; Era; NR3A1; ER-alpha; estradiol receptor; estrogen nuclear receptor alpha; estrogen receptor alpha delta 4 +49 isoform; nuclear receptor subfamily 3 group A member 1; estrogen receptor alpha 3*,4,5,6,7*/822 isoform; estrogen receptor alpha delta 4*,5,6,7*/654 isoform; estrogen receptor alpha delta 4*,5,6,7,8*/901 isoform; estrogen receptor alpha delta 3*,4,5,6,7*/819-2 isoform; estrogen receptor alpha delta 3*,4,5,6,7*,8*/941 isoform; ER; ESRA; DKFZp686N23123; |
Gene ID | 2099 |
mRNA Refseq | NM_000125 |
Protein Refseq | NP_000116 |
UniProt ID | P03372 |
◆ Recombinant Proteins | ||
ESR1-38HFL | Active Recombinant Full Length Human ESR1 Protein, C-Flag-tagged | +Inquiry |
ESR1-784H | Recombinant Human ESR1 Protein, His-tagged | +Inquiry |
ESR1-868H | Recombinant Human ESR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ESR1-1390H | Recombinant Human ESR1 Protein (10-595 aa), His-tagged | +Inquiry |
ESR1-24H | Recombinant Human ESR1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESR1-6540HCL | Recombinant Human ESR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESR1 Products
Required fields are marked with *
My Review for All ESR1 Products
Required fields are marked with *