Recombinant Human ESR1 Protein, His-tagged
Cat.No. : | ESR1-04H |
Product Overview : | Recombinant Human ESR1 Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes an estrogen receptor and ligand-activated transcription factor. The canonical protein contains an N-terminal ligand-independent transactivation domain, a central DNA binding domain, a hinge domain, and a C-terminal ligand-dependent transactivation domain. The protein localizes to the nucleus where it may form either a homodimer or a heterodimer with estrogen receptor 2. The protein encoded by this gene regulates the transcription of many estrogen-inducible genes that play a role in growth, metabolism, sexual development, gestation, and other reproductive functions and is expressed in many non-reproductive tissues. The receptor encoded by this gene plays a key role in breast cancer, endometrial cancer, and osteoporosis. This gene is reported to have dozens of transcript variants due to the use of alternate promoters and alternative splicing, however, the full-length nature of many of these variants remain uncertain. |
Form : | Supplied as a 0.2 μm filtered solution in PBS, pH8.0. |
Molecular Mass : | ~10KDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMLEHHHHHH |
Purity : | > 90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.03mg/mL |
Gene Name | ESR1 estrogen receptor 1 [ Homo sapiens (human) ] |
Official Symbol | ESR1 |
Synonyms | ER; ESR; Era; ESRA; ESTRR; NR3A1 |
Gene ID | 2099 |
mRNA Refseq | NM_000125 |
Protein Refseq | NP_000116 |
MIM | 133430 |
UniProt ID | P03372 |
◆ Recombinant Proteins | ||
ESR1-24H | Recombinant Human ESR1 Protein | +Inquiry |
Esr1-1439R | Recombinant Rat Esr1 protein, His & GST-tagged | +Inquiry |
ESR1-5322H | Recombinant Human ESR1 protein, His-Myc-tagged | +Inquiry |
ESR1-784H | Recombinant Human ESR1 Protein, His-tagged | +Inquiry |
ESR1-6854H | Recombinant Human ESR1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESR1-6540HCL | Recombinant Human ESR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESR1 Products
Required fields are marked with *
My Review for All ESR1 Products
Required fields are marked with *