Recombinant Human ESR2
Cat.No. : | ESR2-28403TH |
Product Overview : | Recombinant fragment of Human Estrogen Receptor beta with proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Isoform beta-1 is expressed in testis and ovary, and at a lower level in heart, brain, placenta, liver, skeletal muscle, spleen, thymus, prostate, colon, bone marrow, mammary gland and uterus. Also found in uterine bone, breast, and ovarian tumor cell lin |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNR |
Sequence Similarities : | Belongs to the nuclear hormone receptor family. NR3 subfamily.Contains 1 nuclear receptor DNA-binding domain. |
Gene Name | ESR2 estrogen receptor 2 (ER beta) [ Homo sapiens ] |
Official Symbol | ESR2 |
Synonyms | ESR2; estrogen receptor 2 (ER beta); estrogen receptor beta; Erb; NR3A2; |
Gene ID | 2100 |
mRNA Refseq | NM_001040275 |
Protein Refseq | NP_001035365 |
MIM | 601663 |
Uniprot ID | Q92731 |
Chromosome Location | 14q21-q22 |
Pathway | Androgen Receptor Signaling Pathway, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Nuclear Receptors, organism-specific biosystem; |
Function | DNA binding; enzyme binding; estrogen receptor activity; ligand-dependent nuclear receptor activity; metal ion binding; |
◆ Recombinant Proteins | ||
ESR2-1809R | Recombinant Rat ESR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ESR2-2152R | Recombinant Rat ESR2 Protein | +Inquiry |
ESR2-1331R | Recombinant Rhesus Macaque ESR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ESR2-2872H | Recombinant Human ESR2 protein, His-tagged | +Inquiry |
ESR2-2867M | Recombinant Mouse ESR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESR2-6539HCL | Recombinant Human ESR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESR2 Products
Required fields are marked with *
My Review for All ESR2 Products
Required fields are marked with *
0
Inquiry Basket