Recombinant Human ESRRA protein, GST-tagged
Cat.No. : | ESRRA-6754H |
Product Overview : | Recombinant Human ESRRA protein(1-65 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-65 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ESRRA estrogen-related receptor alpha [ Homo sapiens ] |
Official Symbol | ESRRA |
Synonyms | ESRRA; estrogen-related receptor alpha; ESRL1; steroid hormone receptor ERR1; ERR1; ERRa; ERRalpha; NR3B1; ERR-alpha; estrogen receptor-like 1; estrogen-related nuclear receptor alpha; nuclear receptor subfamily 3 group B member 1; |
Gene ID | 2101 |
mRNA Refseq | NM_004451 |
Protein Refseq | NP_004442 |
MIM | 601998 |
UniProt ID | P11474 |
◆ Recombinant Proteins | ||
ESRRA-5330M | Recombinant Mouse ESRRA Protein | +Inquiry |
ESRRA-2117H | Recombinant Human ESRRA Protein (1-423 aa), GST-tagged | +Inquiry |
ESRRA-12204Z | Recombinant Zebrafish ESRRA | +Inquiry |
ESRRA-6754H | Recombinant Human ESRRA protein, GST-tagged | +Inquiry |
ESRRA-3508H | Recombinant Human ESRRA Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESRRA-576HCL | Recombinant Human ESRRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESRRA Products
Required fields are marked with *
My Review for All ESRRA Products
Required fields are marked with *