Recombinant Human estrogen receptor 1 Protein, His tagged
Cat.No. : | ESR1-001H |
Product Overview : | Recombinant human estrogen receptor 1 Protein (1-116aa) with C-His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-116aa |
Description : | This gene encodes an estrogen receptor and ligand-activated transcription factor. The canonical protein contains an N-terminal ligand-independent transactivation domain, a central DNA binding domain, a hinge domain, and a C-terminal ligand-dependent transactivation domain. The protein localizes to the nucleus where it may form either a homodimer or a heterodimer with estrogen receptor 2. The protein encoded by this gene regulates the transcription of many estrogen-inducible genes that play a role in growth, metabolism, sexual development, gestation, and other reproductive functions and is expressed in many non-reproductive tissues. The receptor encoded by this gene plays a key role in breast cancer, endometrial cancer, and osteoporosis. This gene is reported to have dozens of transcript variants due to the use of alternate promoters and alternative splicing, however, the full-length nature of many of these variants remain uncertain. |
Tag : | C-His |
Molecular Mass : | 13 kDa |
AA Sequence : | MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4 |
Concentration : | 0.5 mg/mL by BCA |
Gene Name | ESR1 estrogen receptor 1 [ Homo sapiens (human) ] |
Official Symbol | ESR1 |
Synonyms | ESR1; estrogen receptor 1; ESR; estrogen receptor; Era; NR3A1; ER-alpha; estradiol receptor; estrogen nuclear receptor alpha; estrogen receptor alpha delta 4 +49 isoform; nuclear receptor subfamily 3 group A member 1; estrogen receptor alpha 3*,4,5,6,7*/822 isoform; estrogen receptor alpha delta 4*,5,6,7*/654 isoform; estrogen receptor alpha delta 4*,5,6,7,8*/901 isoform; estrogen receptor alpha delta 3*,4,5,6,7*/819-2 isoform; estrogen receptor alpha delta 3*,4,5,6,7*,8*/941 isoform; ER; ESRA; DKFZp686N23123; |
Gene ID | 2099 |
mRNA Refseq | NM_000125 |
Protein Refseq | NP_000116 |
MIM | 133430 |
UniProt ID | P03372 |
◆ Recombinant Proteins | ||
ESR1-784H | Recombinant Human ESR1 Protein, His-tagged | +Inquiry |
ESR1-03HT | Recombinant Human estrogen receptor 1 protein, Y537S and C530S Mutant, His-tagged | +Inquiry |
ESR1-2534H | Recombinant Human ESR1 protein(191-270 aa), C-His-tagged | +Inquiry |
ESR1-014H | Recombinant Human ESR1 Protein | +Inquiry |
ESR1-227H | Recombinant Human ESR1, StrepII-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESR1-6540HCL | Recombinant Human ESR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESR1 Products
Required fields are marked with *
My Review for All ESR1 Products
Required fields are marked with *