Recombinant Human ETF1
Cat.No. : | ETF1-28695TH |
Product Overview : | Recombinant fragment of Human eRF1 with N terminal proprietary tag; Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Termination of protein biosynthesis and release of the nascent polypeptide chain are signaled by the presence of an in-frame stop codon at the aminoacyl site of the ribosome. The process of translation termination is universal and is mediated by protein release factors (RFs) and GTP. A class 1 RF recognizes the stop codon and promotes the hydrolysis of the ester bond linking the polypeptide chain with the peptidyl site tRNA, a reaction catalyzed at the peptidyl transferase center of the ribosome. Class 2 RFs, which are not codon specific and do not recognize codons, stimulate class 1 RF activity and confer GTP dependency upon the process. In prokaryotes, both class 1 RFs, RF1 and RF2, recognize UAA; however, UAG and UGA are decoded specifically by RF1 and RF2, respectively. In eukaryotes, eRF1, or ETF1, the functional counterpart of RF1 and RF2, functions as an omnipotent RF, decoding all 3 stop codons (Frolova et al. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY |
Sequence Similarities : | Belongs to the eukaryotic release factor 1 family. |
Gene Name | ETF1 eukaryotic translation termination factor 1 [ Homo sapiens ] |
Official Symbol | ETF1 |
Synonyms | ETF1; eukaryotic translation termination factor 1; ERF, ERF1, SUP45L1; eukaryotic peptide chain release factor subunit 1; eRF1; polypeptide chain release factor 1; RF1; sup45 (yeast omnipotent suppressor 45) homolog like 1; TB3 1; |
Gene ID | 2107 |
mRNA Refseq | NM_004730 |
Protein Refseq | NP_004721 |
MIM | 600285 |
Uniprot ID | P62495 |
Chromosome Location | 5q31.2 |
Pathway | Eukaryotic Translation Termination, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; |
Function | RNA binding; protein binding; ribosome binding; translation release factor activity; translation release factor activity, codon specific; |
◆ Recombinant Proteins | ||
ETF1-4731HF | Recombinant Full Length Human ETF1 Protein, GST-tagged | +Inquiry |
ETF1-3514H | Recombinant Human ETF1 Protein, GST-tagged | +Inquiry |
Etf1-2878M | Recombinant Mouse Etf1 Protein, Myc/DDK-tagged | +Inquiry |
ETF1-1508R | Recombinant Rhesus monkey ETF1 Protein, His-tagged | +Inquiry |
ETF1-1333R | Recombinant Rhesus Macaque ETF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETF1-6533HCL | Recombinant Human ETF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETF1 Products
Required fields are marked with *
My Review for All ETF1 Products
Required fields are marked with *