Recombinant Human ETV3 Protein, GST-tagged
Cat.No. : | ETV3-3534H |
Product Overview : | Human ETV3 full-length ORF ( AAH22868, 1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ETV3 (ETS Variant 3) is a Protein Coding gene. Diseases associated with ETV3 include Subclavian Steal Syndrome. Among its related pathways are Macrophage Differentiation and Growth Inhibition by METS. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and RNA polymerase II transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is ERF. |
Molecular Mass : | 41.47 kDa |
AA Sequence : | MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVMPNYPFINIRSSGKIQTLLVGN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ETV3 ets variant 3 [ Homo sapiens ] |
Official Symbol | ETV3 |
Synonyms | ETV3; ets variant 3; ets variant gene 3 , ets variant gene 3, ETS family transcriptional repressor; ETS translocation variant 3; PE 1; ETS domain transcriptional repressor PE1; mitogenic Ets transcriptional suppressor; ets variant gene 3, ETS family transcriptional repressor; PE1; METS; PE-1; bA110J1.4; FLJ79173; |
Gene ID | 2117 |
mRNA Refseq | NM_001145312 |
Protein Refseq | NP_001138784 |
MIM | 164873 |
UniProt ID | P41162 |
◆ Recombinant Proteins | ||
ETV3-093H | Recombinant Human ETV3 Protein, HIS-tagged | +Inquiry |
ETV3-5351M | Recombinant Mouse ETV3 Protein | +Inquiry |
ETV3-3534H | Recombinant Human ETV3 Protein, GST-tagged | +Inquiry |
ETV3-2882M | Recombinant Mouse ETV3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ETV3-4367HF | Recombinant Full Length Human ETV3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV3-6523HCL | Recombinant Human ETV3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ETV3 Products
Required fields are marked with *
My Review for All ETV3 Products
Required fields are marked with *