Recombinant Human EVI2B Protein, C-His-tagged
Cat.No. : | EVI2B-028H |
Product Overview : | Recombinant Human EVI2B Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | EVI2B, required for granulocyte differentiation and functionality of hematopoietic progenitor cells through the control of cell cycle progression and survival of hematopoietic progenitor cells. |
Molecular Mass : | ~20 kDa |
AA Sequence : | KTETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAVFTSARQLPSARTSTTQPPKSFVYTFTQQSSSVQIPSRKQITVHNPSTQPTSTVKNSPRSTPGFILDTTSNKQTPQKNNYNS |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | EVI2B ecotropic viral integration site 2B [ Homo sapiens (human) ] |
Official Symbol | EVI2B |
Synonyms | EVI2B; ecotropic viral integration site 2B; protein EVI2B; CD361; D17S376; EVDB; EVI-2B; ecotropic viral integration site 2B protein homolog; |
Gene ID | 2124 |
mRNA Refseq | NM_006495 |
Protein Refseq | NP_006486 |
MIM | 158381 |
UniProt ID | P34910 |
◆ Recombinant Proteins | ||
EVI2B-4376HF | Recombinant Full Length Human EVI2B Protein, GST-tagged | +Inquiry |
EVI2B-028H | Recombinant Human EVI2B Protein, C-His-tagged | +Inquiry |
EVI2B-5357M | Recombinant Mouse EVI2B Protein | +Inquiry |
EVI2B-3546H | Recombinant Human EVI2B Protein, GST-tagged | +Inquiry |
RFL33697HF | Recombinant Full Length Human Protein Evi2B(Evi2B) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EVI2B Products
Required fields are marked with *
My Review for All EVI2B Products
Required fields are marked with *