Recombinant Human EVI2B Protein, C-His-tagged

• Cat.No.: EVI2B-028H
• Product Overview: Recombinant Human EVI2B Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: EVI2B, required for granulocyte differentiation and functionality of hematopoietic progenitor cells through the control of cell cycle progression and survival of hematopoietic progenitor cells.
• Molecular Mass: ~20 kDa
• AA Sequence: KTETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAVFTSARQLPSARTSTTQPPKSFVYTFTQQSSSVQIPSRKQITVHNPSTQPTSTVKNSPRSTPGFILDTTSNKQTPQKNNYNS
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: EVI2B ecotropic viral integration site 2B [ Homo sapiens (human) ]
• Official Symbol: EVI2B
• Synonyms: EVI2B; ecotropic viral integration site 2B; protein EVI2B; CD361; D17S376; EVDB; EVI-2B; ecotropic viral integration site 2B protein homolog
• Gene ID: 2124
• mRNA Refseq: NM_006495
• Protein Refseq: NP_006486
• MIM: 158381
• UniProt ID: P34910