Recombinant Human EVI2B Protein, C-His-tagged

Cat.No. : EVI2B-028H
Product Overview : Recombinant Human EVI2B Protein with C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : EVI2B, required for granulocyte differentiation and functionality of hematopoietic progenitor cells through the control of cell cycle progression and survival of hematopoietic progenitor cells.
Molecular Mass : ~20 kDa
AA Sequence : KTETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAKVTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAVFTSARQLPSARTSTTQPPKSFVYTFTQQSSSVQIPSRKQITVHNPSTQPTSTVKNSPRSTPGFILDTTSNKQTPQKNNYNS
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS, 4M Urea, pH7.4
Gene Name EVI2B ecotropic viral integration site 2B [ Homo sapiens (human) ]
Official Symbol EVI2B
Synonyms EVI2B; ecotropic viral integration site 2B; protein EVI2B; CD361; D17S376; EVDB; EVI-2B; ecotropic viral integration site 2B protein homolog;
Gene ID 2124
mRNA Refseq NM_006495
Protein Refseq NP_006486
MIM 158381
UniProt ID P34910

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EVI2B Products

Required fields are marked with *

My Review for All EVI2B Products

Required fields are marked with *

0
cart-icon