Recombinant Human EXOSC6 Protein, GST-tagged
Cat.No. : | EXOSC6-3577H |
Product Overview : | Human EXOSC6 partial ORF ( NP_478126, 3 a.a. - 66 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 32.78 kDa |
AA Sequence : | GDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EXOSC6 exosome component 6 [ Homo sapiens ] |
Official Symbol | EXOSC6 |
Synonyms | EXOSC6; exosome component 6; exosome complex component MTR3; EAP4; hMtr3p; MTR3; Mtr3 (mRNA transport regulator 3) homolog (yeast); Mtr3p; p11; hMtr3; exosome complex exonuclease MTR3; mRNA transport regulator 3 homolog; Mtr3 (mRNA transport regulator 3)-homolog; homolog of yeast mRNA transport regulator 3; |
Gene ID | 118460 |
mRNA Refseq | NM_058219 |
Protein Refseq | NP_478126 |
MIM | 606490 |
UniProt ID | Q5RKV6 |
◆ Recombinant Proteins | ||
EXOSC6-5386M | Recombinant Mouse EXOSC6 Protein | +Inquiry |
EXOSC6-2904M | Recombinant Mouse EXOSC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
EXOSC6-2689Z | Recombinant Zebrafish EXOSC6 | +Inquiry |
EXOSC6-3577H | Recombinant Human EXOSC6 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EXOSC6 Products
Required fields are marked with *
My Review for All EXOSC6 Products
Required fields are marked with *
0
Inquiry Basket