Recombinant Human EXOSC6 Protein, GST-tagged

Cat.No. : EXOSC6-3577H
Product Overview : Human EXOSC6 partial ORF ( NP_478126, 3 a.a. - 66 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation. [provided by RefSeq, Jul 2008]
Molecular Mass : 32.78 kDa
AA Sequence : GDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EXOSC6 exosome component 6 [ Homo sapiens ]
Official Symbol EXOSC6
Synonyms EXOSC6; exosome component 6; exosome complex component MTR3; EAP4; hMtr3p; MTR3; Mtr3 (mRNA transport regulator 3) homolog (yeast); Mtr3p; p11; hMtr3; exosome complex exonuclease MTR3; mRNA transport regulator 3 homolog; Mtr3 (mRNA transport regulator 3)-homolog; homolog of yeast mRNA transport regulator 3;
Gene ID 118460
mRNA Refseq NM_058219
Protein Refseq NP_478126
MIM 606490
UniProt ID Q5RKV6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EXOSC6 Products

Required fields are marked with *

My Review for All EXOSC6 Products

Required fields are marked with *

0
cart-icon
0
compare icon