Recombinant Human EXOSC9 Protein, GST-tagged
Cat.No. : | EXOSC9-3582H |
Product Overview : | Human EXOSC9 partial ORF ( NP_005024, 124 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of the human exosome, a exoribonuclease complex which processes and degrades RNA in the nucleus and cytoplasm. This component may play a role in mRNA degradation and the polymyositis/scleroderma autoantigen complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 36.41 kDa |
AA Sequence : | DPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITAFKMEKAPID |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EXOSC9 exosome component 9 [ Homo sapiens ] |
Official Symbol | EXOSC9 |
Synonyms | EXOSC9; exosome component 9; PMSCL1, polymyositis/scleroderma autoantigen 1, 75kDa; exosome complex component RRP45; p5; p6; PM/Scl 75; polymyositis/scleroderma autoantigen 1 (75kD); RRP45; Rrp45p; autoantigen PM/Scl 1; PMSCL autoantigen, 75kD; exosome complex exonuclease RRP45; polymyositis/scleroderma autoantigen 1, 75kDa; P75 polymyositis-scleroderma overlap syndrome associated autoantigen; P75 polymyositis-scleroderma overlap syndrome-associated autoantigen; PMSCL1; PM/Scl-75; |
Gene ID | 5393 |
mRNA Refseq | NM_001034194 |
Protein Refseq | NP_001029366 |
MIM | 606180 |
UniProt ID | Q06265 |
◆ Recombinant Proteins | ||
EXOSC9-2172R | Recombinant Rat EXOSC9 Protein | +Inquiry |
EXOSC9-2455H | Recombinant Human EXOSC9 Protein, MYC/DDK-tagged | +Inquiry |
EXOSC9-3582H | Recombinant Human EXOSC9 Protein, GST-tagged | +Inquiry |
EXOSC9-6010H | Recombinant Human EXOSC9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EXOSC9-3286C | Recombinant Chicken EXOSC9 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EXOSC9 Products
Required fields are marked with *
My Review for All EXOSC9 Products
Required fields are marked with *