Recombinant Human EXOSC9 Protein, GST-tagged

• Cat.No.: EXOSC9-3582H
• Product Overview: Human EXOSC9 partial ORF ( NP_005024, 124 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a component of the human exosome, a exoribonuclease complex which processes and degrades RNA in the nucleus and cytoplasm. This component may play a role in mRNA degradation and the polymyositis/scleroderma autoantigen complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]
• Molecular Mass: 36.41 kDa
• AA Sequence: DPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITAFKMEKAPID
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EXOSC9 exosome component 9 [ Homo sapiens ]
• Official Symbol: EXOSC9
• Synonyms: EXOSC9; exosome component 9; PMSCL1, polymyositis/scleroderma autoantigen 1, 75kDa; exosome complex component RRP45; p5; p6; PM/Scl 75; polymyositis/scleroderma autoantigen 1 (75kD); RRP45; Rrp45p; autoantigen PM/Scl 1; PMSCL autoantigen, 75kD; exosome complex exonuclease RRP45; polymyositis/scleroderma autoantigen 1, 75kDa; P75 polymyositis-scleroderma overlap syndrome associated autoantigen; P75 polymyositis-scleroderma overlap syndrome-associated autoantigen; PMSCL1; PM/Scl-75
• Gene ID: 5393
• mRNA Refseq: NM_001034194
• Protein Refseq: NP_001029366
• MIM: 606180
• UniProt ID: Q06265