Recombinant Human EXOSC9 Protein, GST-tagged

Cat.No. : EXOSC9-3582H
Product Overview : Human EXOSC9 partial ORF ( NP_005024, 124 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a component of the human exosome, a exoribonuclease complex which processes and degrades RNA in the nucleus and cytoplasm. This component may play a role in mRNA degradation and the polymyositis/scleroderma autoantigen complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]
Molecular Mass : 36.41 kDa
AA Sequence : DPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITAFKMEKAPID
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EXOSC9 exosome component 9 [ Homo sapiens ]
Official Symbol EXOSC9
Synonyms EXOSC9; exosome component 9; PMSCL1, polymyositis/scleroderma autoantigen 1, 75kDa; exosome complex component RRP45; p5; p6; PM/Scl 75; polymyositis/scleroderma autoantigen 1 (75kD); RRP45; Rrp45p; autoantigen PM/Scl 1; PMSCL autoantigen, 75kD; exosome complex exonuclease RRP45; polymyositis/scleroderma autoantigen 1, 75kDa; P75 polymyositis-scleroderma overlap syndrome associated autoantigen; P75 polymyositis-scleroderma overlap syndrome-associated autoantigen; PMSCL1; PM/Scl-75;
Gene ID 5393
mRNA Refseq NM_001034194
Protein Refseq NP_001029366
MIM 606180
UniProt ID Q06265

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EXOSC9 Products

Required fields are marked with *

My Review for All EXOSC9 Products

Required fields are marked with *

0
cart-icon
0
compare icon