Recombinant Human EXTL1 Protein, GST-tagged
| Cat.No. : | EXTL1-3587H |
| Product Overview : | Human EXTL1 partial ORF ( NP_004446, 141 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the multiple exostoses (EXT) family of glycosyltransferases, which function in the chain polymerization of heparan sulfate and heparin. The encoded protein harbors alpha 1,4- N-acetylglucosaminyltransferase activity, and is involved in chain elongation of heparan sulfate and possibly heparin. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.85 kDa |
| AA Sequence : | AQTGECSSMPLQWNRGRNHLVLRLHPAPCPRTFQLGQAMVAEASPTVDSFRPGFDVALPFLPEAHPLRGGAPGQLRQHSPQPGVALLALEEERGGWRTADT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EXTL1 exostoses (multiple)-like 1 [ Homo sapiens ] |
| Official Symbol | EXTL1 |
| Synonyms | exostoses (multiple)-like 1; 3515; Ensembl:ENSG00000158008; MGC70794; exostosin-like 1;exostosin-L;multiple exostosis-like protein;alpha-N-acetylglucosaminyltransferase II;glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase;glucuronyl-N-acetylglucosaminylproteoglycan alpha-1,4-N- acetylglucosaminyltransferase;glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N- acetylglucosaminyltransferase; 2.4.1.224; EXTL |
| Gene ID | 2134 |
| mRNA Refseq | NM_004455 |
| Protein Refseq | NP_004446 |
| MIM | 601738 |
| UniProt ID | Q92935 |
| ◆ Recombinant Proteins | ||
| EXTL1-12605H | Recombinant Human EXTL1, His-tagged | +Inquiry |
| Extl1-2896M | Recombinant Mouse Extl1 Protein, Myc/DDK-tagged | +Inquiry |
| EXTL1-3587H | Recombinant Human EXTL1 Protein, GST-tagged | +Inquiry |
| EXTL1-2684H | Recombinant Human EXTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EXTL1-6495HCL | Recombinant Human EXTL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EXTL1 Products
Required fields are marked with *
My Review for All EXTL1 Products
Required fields are marked with *
