Recombinant Human EXTL1 Protein, GST-tagged

Cat.No. : EXTL1-3587H
Product Overview : Human EXTL1 partial ORF ( NP_004446, 141 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the multiple exostoses (EXT) family of glycosyltransferases, which function in the chain polymerization of heparan sulfate and heparin. The encoded protein harbors alpha 1,4- N-acetylglucosaminyltransferase activity, and is involved in chain elongation of heparan sulfate and possibly heparin. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.85 kDa
AA Sequence : AQTGECSSMPLQWNRGRNHLVLRLHPAPCPRTFQLGQAMVAEASPTVDSFRPGFDVALPFLPEAHPLRGGAPGQLRQHSPQPGVALLALEEERGGWRTADT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EXTL1 exostoses (multiple)-like 1 [ Homo sapiens ]
Official Symbol EXTL1
Synonyms exostoses (multiple)-like 1; 3515; Ensembl:ENSG00000158008; MGC70794; exostosin-like 1;exostosin-L;multiple exostosis-like protein;alpha-N-acetylglucosaminyltransferase II;glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase;glucuronyl-N-acetylglucosaminylproteoglycan alpha-1,4-N- acetylglucosaminyltransferase;glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N- acetylglucosaminyltransferase; 2.4.1.224; EXTL
Gene ID 2134
mRNA Refseq NM_004455
Protein Refseq NP_004446
MIM 601738
UniProt ID Q92935

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EXTL1 Products

Required fields are marked with *

My Review for All EXTL1 Products

Required fields are marked with *

0
cart-icon