Recombinant Human EXTL2 Protein, GST-tagged

Cat.No. : EXTL2-3588H
Product Overview : Human EXTL2 full-length ORF ( AAH36015, 39 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : EXTL2 (Exostosin Like Glycosyltransferase 2) is a Protein Coding gene. Diseases associated with EXTL2 include Hereditary Multiple Osteochondromas and Mucopolysaccharidoses. Among its related pathways are heparan sulfate biosynthesis and Metabolism. GO annotations related to this gene include transferase activity, transferring hexosyl groups and alpha-1,4-N-acetylgalactosaminyltransferase activity. An important paralog of this gene is EXTL3.
Molecular Mass : 57.86 kDa
AA Sequence : LLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNITISQFGFPYANYKRKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EXTL2 exostoses (multiple)-like 2 [ Homo sapiens ]
Official Symbol EXTL2
Synonyms EXTL2; exostoses (multiple)-like 2; exostosin-like 2; alpha 1; 4 N acteylhexosaminyltransferase; alpha-GalNAcT EXTL2; EXT-related protein 2; processed exostosin-like 2; alpha-1,4-N-acteylhexosaminyltransferase; alpha-1,4-N-acetylhexosaminyltransferase EXTL2; glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase; EXTR2;
Gene ID 2135
mRNA Refseq NM_001033025
Protein Refseq NP_001028197
MIM 602411
UniProt ID Q9UBQ6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EXTL2 Products

Required fields are marked with *

My Review for All EXTL2 Products

Required fields are marked with *

0
cart-icon