Recombinant Human EYA1

Cat.No. : EYA1-26641TH
Product Overview : Recombinant fragment, corresponding to amino acids 100-170 of Human EYA1, with an N-terminal proprietary tag, predicted MWt 33.44 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 71 amino acids
Description : This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and sporadic cases of congenital cataracts and ocular anterior segment anomalies. A similar protein in mice can act as a transcriptional activator. Four transcript variants encoding three distinct isoforms have been identified for this gene.
Molecular Weight : 33.440kDa inclusive of tags
Tissue specificity : In the embryo, highly expressed in kidney with lower levels in brain. Weakly expressed in lung. In the adult, highly expressed in heart and skeletal muscle. Weakly expressed in brain and liver. No expression in eye or kidney.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSF
Sequence Similarities : Belongs to the HAD-like hydrolase superfamily. EYA family.
Gene Name EYA1 eyes absent homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol EYA1
Synonyms EYA1; eyes absent homolog 1 (Drosophila); BOR, eyes absent (Drosophila) homolog 1; eyes absent homolog 1;
Gene ID 2138
mRNA Refseq NM_000503
Protein Refseq NP_000494
MIM 601653
Uniprot ID Q99502
Chromosome Location 8q13.3
Pathway Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function hydrolase activity; metal ion binding; protein tyrosine phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EYA1 Products

Required fields are marked with *

My Review for All EYA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon