Recombinant Human EYA1
Cat.No. : | EYA1-26641TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 100-170 of Human EYA1, with an N-terminal proprietary tag, predicted MWt 33.44 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 71 amino acids |
Description : | This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and sporadic cases of congenital cataracts and ocular anterior segment anomalies. A similar protein in mice can act as a transcriptional activator. Four transcript variants encoding three distinct isoforms have been identified for this gene. |
Molecular Weight : | 33.440kDa inclusive of tags |
Tissue specificity : | In the embryo, highly expressed in kidney with lower levels in brain. Weakly expressed in lung. In the adult, highly expressed in heart and skeletal muscle. Weakly expressed in brain and liver. No expression in eye or kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSF |
Sequence Similarities : | Belongs to the HAD-like hydrolase superfamily. EYA family. |
Gene Name | EYA1 eyes absent homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | EYA1 |
Synonyms | EYA1; eyes absent homolog 1 (Drosophila); BOR, eyes absent (Drosophila) homolog 1; eyes absent homolog 1; |
Gene ID | 2138 |
mRNA Refseq | NM_000503 |
Protein Refseq | NP_000494 |
MIM | 601653 |
Uniprot ID | Q99502 |
Chromosome Location | 8q13.3 |
Pathway | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | hydrolase activity; metal ion binding; protein tyrosine phosphatase activity; |
◆ Recombinant Proteins | ||
EYA1-26641TH | Recombinant Human EYA1 | +Inquiry |
EYA1-48H | Recombinant Human EYA1 protein | +Inquiry |
EYA1-4456HF | Recombinant Full Length Human EYA1 Protein, GST-tagged | +Inquiry |
EYA1-8797Z | Recombinant Zebrafish EYA1 | +Inquiry |
EYA1-3590H | Recombinant Human EYA1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EYA1-6492HCL | Recombinant Human EYA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EYA1 Products
Required fields are marked with *
My Review for All EYA1 Products
Required fields are marked with *
0
Inquiry Basket