Recombinant Human EYA2 Protein, GST-tagged
| Cat.No. : | EYA2-3592H |
| Product Overview : | Human EYA2 full-length ORF ( NP_005235.3, 1 a.a. - 538 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may be post-translationally modified and may play a role in eye development. A similar protein in mice can act as a transcriptional activator. Alternative splicing results in multiple transcript variants, but the full-length natures of all of these variants have not yet been determined. [provided by RefSeq, Jul 2009] |
| Molecular Mass : | 85.6 kDa |
| AA Sequence : | MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EYA2 eyes absent homolog 2 (Drosophila) [ Homo sapiens ] |
| Official Symbol | EYA2 |
| Synonyms | EYA2; eyes absent homolog 2 (Drosophila); eyes absent (Drosophila) homolog 2; eyes absent homolog 2; EAB1; MGC10614; |
| Gene ID | 2139 |
| mRNA Refseq | NM_005244 |
| Protein Refseq | NP_005235 |
| MIM | 601654 |
| UniProt ID | O00167 |
| ◆ Recombinant Proteins | ||
| EYA2-2910M | Recombinant Mouse EYA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EYA2-1281Z | Recombinant Zebrafish EYA2 | +Inquiry |
| EYA2-3592H | Recombinant Human EYA2 Protein, GST-tagged | +Inquiry |
| EYA2-3101H | Recombinant Human EYA2 protein, His-tagged | +Inquiry |
| EYA2-2876H | Recombinant Human EYA2 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EYA2-6491HCL | Recombinant Human EYA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EYA2 Products
Required fields are marked with *
My Review for All EYA2 Products
Required fields are marked with *
