Recombinant Human EYA2 protein, His-tagged
| Cat.No. : | EYA2-3101H |
| Product Overview : | Recombinant Human EYA2 protein(241-583 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 15, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 241-583 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | EYA2 eyes absent homolog 2 (Drosophila) [ Homo sapiens ] |
| Official Symbol | EYA2 |
| Synonyms | EYA2; eyes absent homolog 2 (Drosophila); eyes absent (Drosophila) homolog 2; eyes absent homolog 2; EAB1; MGC10614; |
| Gene ID | 2139 |
| mRNA Refseq | NM_005244 |
| Protein Refseq | NP_005235 |
| MIM | 601654 |
| UniProt ID | O00167 |
| ◆ Recombinant Proteins | ||
| EYA2-1281Z | Recombinant Zebrafish EYA2 | +Inquiry |
| EYA2-5397M | Recombinant Mouse EYA2 Protein | +Inquiry |
| EYA2-2876H | Recombinant Human EYA2 protein, His-SUMO-tagged | +Inquiry |
| EYA2-2910M | Recombinant Mouse EYA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EYA2-3592H | Recombinant Human EYA2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EYA2-6491HCL | Recombinant Human EYA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EYA2 Products
Required fields are marked with *
My Review for All EYA2 Products
Required fields are marked with *
