Recombinant Human EYS Protein, GST-tagged

Cat.No. : EYS-3596H
Product Overview : Human EYS partial ORF ( XP_498111, 309 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene contains multiple epidermal growth factor (EGF)-like and LamG domains. The protein is expressed in the photoreceptor layer of the retina, and the gene is mutated in autosomal recessive retinitis pigmentosa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]
Molecular Mass : 36.63 kDa
AA Sequence : HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EYS eyes shut homolog (Drosophila) [ Homo sapiens ]
Official Symbol EYS
Synonyms EYS; eyes shut homolog (Drosophila); C6orf178, C6orf179, C6orf180, chromosome 6 open reading frame 178 , chromosome 6 open reading frame 179 , chromosome 6 open reading frame 180 , EGF like domain, multiple 10 , EGF like domain, multiple 11 , EGFL10, EGFL11, retinitis pigmentosa 25 (autosomal recessive) , RP25; protein eyes shut homolog; bA74E24.1; bA166P24.2; bA307F22.3; dJ303F19.1; dJ1018A4.2; SPAM; protein spacemaker homolog; EGF-like-domain, multiple 10; EGF-like-domain, multiple 11; epidermal growth factor-like protein 10; epidermal growth factor-like protein 11; RP25; EGFL10; EGFL11; C6orf178; C6orf179; C6orf180; dJ22I17.2; KIAA0663;
Gene ID 346007
mRNA Refseq NM_001142800
Protein Refseq NP_001136272
MIM 612424
UniProt ID Q5T1H1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EYS Products

Required fields are marked with *

My Review for All EYS Products

Required fields are marked with *

0
cart-icon
0
compare icon