Recombinant Human EYS Protein, GST-tagged
| Cat.No. : | EYS-3596H |
| Product Overview : | Human EYS partial ORF ( XP_498111, 309 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The product of this gene contains multiple epidermal growth factor (EGF)-like and LamG domains. The protein is expressed in the photoreceptor layer of the retina, and the gene is mutated in autosomal recessive retinitis pigmentosa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRKVNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EYS eyes shut homolog (Drosophila) [ Homo sapiens ] |
| Official Symbol | EYS |
| Synonyms | EYS; eyes shut homolog (Drosophila); C6orf178, C6orf179, C6orf180, chromosome 6 open reading frame 178 , chromosome 6 open reading frame 179 , chromosome 6 open reading frame 180 , EGF like domain, multiple 10 , EGF like domain, multiple 11 , EGFL10, EGFL11, retinitis pigmentosa 25 (autosomal recessive) , RP25; protein eyes shut homolog; bA74E24.1; bA166P24.2; bA307F22.3; dJ303F19.1; dJ1018A4.2; SPAM; protein spacemaker homolog; EGF-like-domain, multiple 10; EGF-like-domain, multiple 11; epidermal growth factor-like protein 10; epidermal growth factor-like protein 11; RP25; EGFL10; EGFL11; C6orf178; C6orf179; C6orf180; dJ22I17.2; KIAA0663; |
| Gene ID | 346007 |
| mRNA Refseq | NM_001142800 |
| Protein Refseq | NP_001136272 |
| MIM | 612424 |
| UniProt ID | Q5T1H1 |
| ◆ Recombinant Proteins | ||
| EYS-3596H | Recombinant Human EYS Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EYS-6489HCL | Recombinant Human EYS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EYS Products
Required fields are marked with *
My Review for All EYS Products
Required fields are marked with *
