Recombinant Human F11 Protein (19-387 aa), His-tagged
Cat.No. : | F11-2004H |
Product Overview : | Recombinant Human F11 Protein (19-387 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-387 aa |
Description : | Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 45.2 kDa |
AA Sequence : | ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | F11 coagulation factor XI [ Homo sapiens ] |
Official Symbol | F11 |
Synonyms | F11; coagulation factor XI; FXI; PTA; MGC141891; |
Gene ID | 2160 |
mRNA Refseq | NM_000128 |
Protein Refseq | NP_000119 |
MIM | 264900 |
UniProt ID | P03951 |
◆ Recombinant Proteins | ||
F11-2914M | Recombinant Mouse F11 Protein, His (Fc)-Avi-tagged | +Inquiry |
F11-5333R | Recombinant Rat F11 protein, His&Myc-tagged | +Inquiry |
F11-900M | Recombinant Mouse F11 Protein, His-tagged | +Inquiry |
F11-4476HF | Recombinant Full Length Human F11 Protein, GST-tagged | +Inquiry |
F11-4100H | Recombinant Human F11 Protein (Met1-Val625), C-His tagged | +Inquiry |
◆ Native Proteins | ||
F11-2466H | Native Human Coagulation Factor XI | +Inquiry |
◆ Cell & Tissue Lysates | ||
F11-2681HCL | Recombinant Human F11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F11 Products
Required fields are marked with *
My Review for All F11 Products
Required fields are marked with *