Recombinant Human F11 Protein (19-387 aa), His-tagged
| Cat.No. : | F11-2004H |
| Product Overview : | Recombinant Human F11 Protein (19-387 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-387 aa |
| Description : | Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 45.2 kDa |
| AA Sequence : | ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | F11 coagulation factor XI [ Homo sapiens ] |
| Official Symbol | F11 |
| Synonyms | F11; coagulation factor XI; FXI; PTA; MGC141891; |
| Gene ID | 2160 |
| mRNA Refseq | NM_000128 |
| Protein Refseq | NP_000119 |
| MIM | 264900 |
| UniProt ID | P03951 |
| ◆ Recombinant Proteins | ||
| F11-957H | Recombinant Human F11 Protein, MYC/DDK-tagged | +Inquiry |
| F11-3602H | Recombinant Human F11 Protein, GST-tagged | +Inquiry |
| F11-4476HF | Recombinant Full Length Human F11 Protein, GST-tagged | +Inquiry |
| F11-439M | Recombinant Mouse F11 Protein, MYC/DDK-tagged | +Inquiry |
| F11-5333R | Recombinant Rat F11 protein, His&Myc-tagged | +Inquiry |
| ◆ Native Proteins | ||
| F11-2466H | Native Human Coagulation Factor XI | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| F11-2681HCL | Recombinant Human F11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F11 Products
Required fields are marked with *
My Review for All F11 Products
Required fields are marked with *
