Recombinant Human F11 Protein (19-387 aa), His-tagged

• Cat.No.: F11-2004H
• Product Overview: Recombinant Human F11 Protein (19-387 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 19-387 aa
• Description: Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 45.2 kDa
• AA Sequence: ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: F11 coagulation factor XI [ Homo sapiens ]
• Official Symbol: F11
• Synonyms: F11; coagulation factor XI; FXI; PTA; MGC141891
• Gene ID: 2160
• mRNA Refseq: NM_000128
• Protein Refseq: NP_000119
• MIM: 264900
• UniProt ID: P03951