Recombinant Human F11R protein, His-tagged
| Cat.No. : | F11R-2769H |
| Product Overview : | Recombinant Human F11R protein(28-162 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 31, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 28-162 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | F11R F11 receptor [ Homo sapiens ] |
| Official Symbol | F11R |
| Synonyms | F11R; F11 receptor; JAM1, junctional adhesion molecule 1; junctional adhesion molecule A; CD321; JAM 1; JAM A; JAMA; JCAM; PAM 1; platelet F11 receptor; platelet adhesion molecule 1; junctional adhesion molecule 1; JAM; KAT; JAM1; PAM-1; |
| Gene ID | 50848 |
| mRNA Refseq | NM_016946 |
| Protein Refseq | NP_058642 |
| MIM | 605721 |
| UniProt ID | Q9Y624 |
| ◆ Recombinant Proteins | ||
| F11R-3604H | Recombinant Human F11R Protein | +Inquiry |
| F11r-44M | Recombinant Mouse F11r Protein, His (Fc)-Avi-tagged | +Inquiry |
| F11R-1731R | Recombinant Rhesus Monkey F11R Protein | +Inquiry |
| F11R-1832R | Recombinant Rat F11R Protein, His (Fc)-Avi-tagged | +Inquiry |
| F11R-301280H | Recombinant Human F11R protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| F11R-2127MCL | Recombinant Mouse F11R cell lysate | +Inquiry |
| F11R-163HKCL | Human F11R Knockdown Cell Lysate | +Inquiry |
| F11R-2741HCL | Recombinant Human F11R cell lysate | +Inquiry |
| F11R-1437RCL | Recombinant Rat F11R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F11R Products
Required fields are marked with *
My Review for All F11R Products
Required fields are marked with *
