Recombinant Human F13A1 protein(431-520 aa), C-His-tagged

Cat.No. : F13A1-2497H
Product Overview : Recombinant Human F13A1 protein(P00488)(431-520 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 431-520 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : FVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSNVD
Gene Name F13A1 coagulation factor XIII, A1 polypeptide [ Homo sapiens ]
Official Symbol F13A1
Synonyms F13A1; coagulation factor XIII, A1 polypeptide; F13A; coagulation factor XIII A chain; TGase; factor XIIIa; fibrinoligase; FSF, A subunit; coagulation factor XIIIa; transglutaminase A chain; transglutaminase. plasma; fibrin stabilizing factor, A subunit; coagulation factor XIII, A polypeptide; protein-glutamine gamma-glutamyltransferase A chain; bA525O21.1 (coagulation factor XIII, A1 polypeptide);
Gene ID 2162
mRNA Refseq NM_000129
Protein Refseq NP_000120
MIM 134570
UniProt ID P00488

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All F13A1 Products

Required fields are marked with *

My Review for All F13A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon