Recombinant Human F13A1 protein(431-520 aa), C-His-tagged
Cat.No. : | F13A1-2497H |
Product Overview : | Recombinant Human F13A1 protein(P00488)(431-520 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 431-520 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | FVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSNVD |
Gene Name | F13A1 coagulation factor XIII, A1 polypeptide [ Homo sapiens ] |
Official Symbol | F13A1 |
Synonyms | F13A1; coagulation factor XIII, A1 polypeptide; F13A; coagulation factor XIII A chain; TGase; factor XIIIa; fibrinoligase; FSF, A subunit; coagulation factor XIIIa; transglutaminase A chain; transglutaminase. plasma; fibrin stabilizing factor, A subunit; coagulation factor XIII, A polypeptide; protein-glutamine gamma-glutamyltransferase A chain; bA525O21.1 (coagulation factor XIII, A1 polypeptide); |
Gene ID | 2162 |
mRNA Refseq | NM_000129 |
Protein Refseq | NP_000120 |
MIM | 134570 |
UniProt ID | P00488 |
◆ Recombinant Proteins | ||
F13A1-2497H | Recombinant Human F13A1 protein(431-520 aa), C-His-tagged | +Inquiry |
F13a1-1499M | Recombinant Mouse F13a1 protein, His & T7-tagged | +Inquiry |
F13A1-1437HFL | Recombinant Full Length Human F13A1 Protein, C-Flag-tagged | +Inquiry |
F13a1-2900M | Recombinant Mouse F13a1 Protein, Myc/DDK-tagged | +Inquiry |
F13A1-12618H | Recombinant Human F13A1, His-tagged | +Inquiry |
◆ Native Proteins | ||
F13A1-28806TH | Native Human F13A1 | +Inquiry |
F13A1-1881H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
F13A1-5399H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
F13A1-6485HCL | Recombinant Human F13A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F13A1 Products
Required fields are marked with *
My Review for All F13A1 Products
Required fields are marked with *
0
Inquiry Basket