Recombinant Human F13A1 protein(431-520 aa), C-His-tagged

• Cat.No.: F13A1-2497H
• Product Overview: Recombinant Human F13A1 protein(P00488)(431-520 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 431-520 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: FVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSNVD

Gene Information

• Gene Name: F13A1 coagulation factor XIII, A1 polypeptide [ Homo sapiens ]
• Official Symbol: F13A1
• Synonyms: F13A1; coagulation factor XIII, A1 polypeptide; F13A; coagulation factor XIII A chain; TGase; factor XIIIa; fibrinoligase; FSF, A subunit; coagulation factor XIIIa; transglutaminase A chain; transglutaminase. plasma; fibrin stabilizing factor, A subunit; coagulation factor XIII, A polypeptide; protein-glutamine gamma-glutamyltransferase A chain; bA525O21.1 (coagulation factor XIII, A1 polypeptide)
• Gene ID: 2162
• mRNA Refseq: NM_000129
• Protein Refseq: NP_000120
• MIM: 134570
• UniProt ID: P00488