Recombinant Human F13B protein(260-403aa), His-GST&Myc-tagged
Cat.No. : | F13B-6213H |
Product Overview : | Recombinant Human F13B protein(P05160)(260-403aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 260-403aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.5 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | WYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHIECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKVTYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVM |
Gene Name | F13B coagulation factor XIII, B polypeptide [ Homo sapiens ] |
Official Symbol | F13B |
Synonyms | F13B; coagulation factor XIII, B polypeptide; coagulation factor XIII B chain; FXIIIB; TGase; transglutaminase B chain; fibrin-stabilizing factor B subunit; protein-glutamine gamma-glutamyltransferase B chain; |
Gene ID | 2165 |
mRNA Refseq | NM_001994 |
Protein Refseq | NP_001985 |
MIM | 134580 |
UniProt ID | P05160 |
◆ Recombinant Proteins | ||
F13B-6213H | Recombinant Human F13B protein(260-403aa), His-GST&Myc-tagged | +Inquiry |
F13B-1121H | Recombinant Human F13B protein, His-tagged | +Inquiry |
F13b-7172M | Recombinant Mouse F13b protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
F13B-1862HCL | Recombinant Human F13B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F13B Products
Required fields are marked with *
My Review for All F13B Products
Required fields are marked with *
0
Inquiry Basket