Recombinant Human F13B protein(260-403aa), His-GST&Myc-tagged

• Cat.No.: F13B-6213H
• Product Overview: Recombinant Human F13B protein(P05160)(260-403aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His&Myc
• Protein Length: 260-403aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.5 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: WYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHIECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKVTYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVM

Gene Information

• Gene Name: F13B coagulation factor XIII, B polypeptide [ Homo sapiens ]
• Official Symbol: F13B
• Synonyms: F13B; coagulation factor XIII, B polypeptide; coagulation factor XIII B chain; FXIIIB; TGase; transglutaminase B chain; fibrin-stabilizing factor B subunit; protein-glutamine gamma-glutamyltransferase B chain
• Gene ID: 2165
• mRNA Refseq: NM_001994
• Protein Refseq: NP_001985
• MIM: 134580
• UniProt ID: P05160