Recombinant Human F2RL1 Protein, GST-Tagged

Cat.No. : F2RL1-3616H
Product Overview : Recombinant Human F2RL1 Protein, GST-Tagged was expressed in Wheat Germ cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the G-protein coupled receptor 1 family of proteins. The encoded cell surface receptor is activated through proteolytic cleavage of its extracellular amino terminus, resulting in a new amino terminus that acts as a tethered ligand that binds to an extracellular loop domain. Activation of the receptor has been shown to stimulate vascular smooth muscle relaxation, dilate blood vessels, increase blood flow, and lower blood pressure. This protein is also important in the inflammatory response, as well as innate and adaptive immunity.
Molecular Mass : 37.95 kDa
AA Sequence : LIGKVDGTSHVTGKGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNNWIYGEALCN
Applications : Enzyme-linked Immunoabsorbent Assay. Western Blot (Recombinant protein). Antibody Production. Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purification : Glutathione Sepharose 4 Fast Flow
Gene Name F2RL1 F2R like trypsin receptor 1 [ Homo sapiens (human) ]
Official Symbol F2RL1
Synonyms PAR2; GPR11
Gene ID 2150
mRNA Refseq NM_005242.6
Protein Refseq NP_005233.4
MIM 600933

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All F2RL1 Products

Required fields are marked with *

My Review for All F2RL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon