Recombinant Human F3 Protein, GST-tagged

Cat.No. : F3-3620H
Product Overview : Human F3 partial ORF ( AAH11029, 45 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants.[provided by RefSeq, May 2010]
Molecular Mass : 37.84 kDa
AA Sequence : TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name F3 coagulation factor III (thromboplastin, tissue factor) [ Homo sapiens ]
Official Symbol F3
Synonyms F3; coagulation factor III (thromboplastin, tissue factor); tissue factor; CD142; TF; TFA; FLJ17960;
Gene ID 2152
mRNA Refseq NM_001178096
Protein Refseq NP_001171567
MIM 134390
UniProt ID P13726

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All F3 Products

Required fields are marked with *

My Review for All F3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon