Recombinant Human F3 Protein, GST-tagged
| Cat.No. : | F3-3620H |
| Product Overview : | Human F3 partial ORF ( AAH11029, 45 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants.[provided by RefSeq, May 2010] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | F3 coagulation factor III (thromboplastin, tissue factor) [ Homo sapiens ] |
| Official Symbol | F3 |
| Synonyms | F3; coagulation factor III (thromboplastin, tissue factor); tissue factor; CD142; TF; TFA; FLJ17960; |
| Gene ID | 2152 |
| mRNA Refseq | NM_001178096 |
| Protein Refseq | NP_001171567 |
| MIM | 134390 |
| UniProt ID | P13726 |
| ◆ Recombinant Proteins | ||
| F3-847H | Recombinant Human F3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| F3-4499HF | Recombinant Full Length Human F3 Protein | +Inquiry |
| F3-5353H | Recombinant Human F3 protein, His-tagged | +Inquiry |
| F3-2109HFL | Recombinant Full Length Human F3 Protein, C-Flag-tagged | +Inquiry |
| F3-565H | Recombinant Human F3 Protein (Met1-Ser295), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| F3-1691HCL | Recombinant Human F3 cell lysate | +Inquiry |
| F3-1256RCL | Recombinant Rat F3 cell lysate | +Inquiry |
| F3-2503MCL | Recombinant Mouse F3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F3 Products
Required fields are marked with *
My Review for All F3 Products
Required fields are marked with *
