Recombinant Human F3 protein, His-tagged
Cat.No. : | F3-4677H |
Product Overview : | Recombinant Human F3 protein(P13726)(33-251 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 33-251 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 26.8 kDa |
AASequence : | SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | F3 coagulation factor III (thromboplastin, tissue factor) [ Homo sapiens ] |
Official Symbol | F3 |
Synonyms | F3; coagulation factor III (thromboplastin, tissue factor); tissue factor; CD142; TF; TFA; FLJ17960; |
Gene ID | 2152 |
mRNA Refseq | NM_001178096 |
Protein Refseq | NP_001171567 |
MIM | 134390 |
UniProt ID | P13726 |
◆ Recombinant Proteins | ||
F3-368R | Recombinant Rabbit F3 Protein, His-tagged | +Inquiry |
F3-883H | Recombinant Human F3 Protein, His (Fc)-Avi-tagged | +Inquiry |
F3-029H | Recombinant Human F3 Protein, C-His-tagged | +Inquiry |
F3-426M | Active Recombinant Mouse F3 protein, His-tagged | +Inquiry |
F3-4096H | Recombinant Human F3 Protein (Met1-Glu251), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
F3-1256RCL | Recombinant Rat F3 cell lysate | +Inquiry |
F3-2503MCL | Recombinant Mouse F3 cell lysate | +Inquiry |
F3-1691HCL | Recombinant Human F3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F3 Products
Required fields are marked with *
My Review for All F3 Products
Required fields are marked with *