Recombinant Human F3 protein, His-tagged
| Cat.No. : | F3-4677H |
| Product Overview : | Recombinant Human F3 protein(P13726)(33-251 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 33-251 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 26.8 kDa |
| AASequence : | SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | F3 coagulation factor III (thromboplastin, tissue factor) [ Homo sapiens ] |
| Official Symbol | F3 |
| Synonyms | F3; coagulation factor III (thromboplastin, tissue factor); tissue factor; CD142; TF; TFA; FLJ17960; |
| Gene ID | 2152 |
| mRNA Refseq | NM_001178096 |
| Protein Refseq | NP_001171567 |
| MIM | 134390 |
| UniProt ID | P13726 |
| ◆ Recombinant Proteins | ||
| F3-1474H | Recombinant Human F3 Protein (Met1-Glu251), N-His tagged | +Inquiry |
| F3-18H | Recombinant Human Tissue Factor, Non-Lipidated | +Inquiry |
| F3-99H | Recombinant Human F3, His-tagged | +Inquiry |
| F3-2735R | Active Recombinant Rat F3 protein, His-tagged | +Inquiry |
| F3-459M | Active Recombinant Mouse Coagulation Factor III | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| F3-1256RCL | Recombinant Rat F3 cell lysate | +Inquiry |
| F3-1691HCL | Recombinant Human F3 cell lysate | +Inquiry |
| F3-2503MCL | Recombinant Mouse F3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F3 Products
Required fields are marked with *
My Review for All F3 Products
Required fields are marked with *
